SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428216769|ref|YP_007101234.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428216769|ref|YP_007101234.1|
Domain Number 1 Region: 2062-2217,2249-2413
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000000000000915
Family Soluble quinoprotein glucose dehydrogenase 0.0035
Further Details:      
 
Domain Number 2 Region: 647-772
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000017
Family YxiM N-terminal domain-like 0.015
Further Details:      
 
Domain Number 3 Region: 904-1031
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000315
Family YxiM N-terminal domain-like 0.021
Further Details:      
 
Domain Number 4 Region: 1177-1290
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000502
Family YxiM N-terminal domain-like 0.016
Further Details:      
 
Domain Number 5 Region: 1441-1552
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000638
Family YxiM N-terminal domain-like 0.021
Further Details:      
 
Domain Number 6 Region: 2462-2540
Classification Level Classification E-value
Superfamily E set domains 0.000000322
Family E-set domains of sugar-utilizing enzymes 0.0061
Further Details:      
 
Domain Number 7 Region: 1557-1704
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000247
Family YxiM N-terminal domain-like 0.03
Further Details:      
 
Domain Number 8 Region: 1975-2054
Classification Level Classification E-value
Superfamily E set domains 0.00000252
Family E-set domains of sugar-utilizing enzymes 0.01
Further Details:      
 
Domain Number 9 Region: 772-873
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000641
Family Cadherin 0.026
Further Details:      
 
Domain Number 10 Region: 518-618
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000204
Family Cadherin 0.024
Further Details:      
 
Domain Number 11 Region: 1031-1132
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000314
Family Cadherin 0.026
Further Details:      
 
Domain Number 12 Region: 1296-1395
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000445
Family Cadherin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428216769|ref|YP_007101234.1|
Sequence length 2544
Comment hypothetical protein Pse7367_0498 [Pseudanabaena sp. PCC 7367]
Sequence
MSFLETNSELIAAFPGINSSTTALSQGFTQGAGLNSGELGGVVFVDERAASAGNFAAGAL
PGLEVVFLDADRDGVAQIGEYLSGFGGFGQGFGQVSAIHIISHAASGGMQLGASWLGQET
IDSYSEAIAGWQNSLTADADILLYGCNVAKGEAGLGFVQSLSQLSGADVAASDDLTGSSL
LGGDWDLEVTTGAIESPTAFSTAFTEEFNDILPTIAQAELVIEPPDNNIVTSSTYSSGSF
QISNNSDSGIQIERVVIDISTAILPDLIFDPFGTAGDPIGKDFTPDSGESATGQDSHTFL
APHDGNSTFGYDALEIVFTDFDPGETFTFSIDNDPTSTQGLPAPGPNHAASVSGLELAGT
TVTIDFSDGNSYTAATYRIPNSEVGSQAIVKEQLPTAPTIEVLGGITTPDTSEIANQVIR
VSAPVGADVSLLQFETALFTDNGSGFDLDPFEANAIVSVDEQSATVGSTGFVDIPVTLTN
TDPEAGLNYFTAVVTDSDGSTSLLADTEILQLLGANNAPTTSGIIDVSVVEGEVDSVIDL
FSVFDDIEDADADLIYSIESNSEPTLFDDVAINPTTGELTLTYAATAVVGTSDLTIRATD
TDGLFVETSFNVAVTEDNSGGGGNPATLLINAGGSAYTDSLNQQWVADEHFTNGKTFGTS
QGISGTTDDPLYQTERYNANLAYEIPVADGEYQVTLEFAELYHNSAGNRVFDVLAEGQLF
VDDLDIYAQVGKNAAYTETFTIPVSDGILDLDFAASADNAKVSAIAIAPVGDLPPQVPTT
SGISDLSVVEGEVNSVVDLFAAFDDFEDADADLIYSIENNSDPSLFDDVAINPTTGELTL
TYAAIAVVGTSDLTIRATDTDGLFVETSFNVAVTEDNSGGGGNPATLLINAGGSAYTDSL
NQQWVADDYFTNGKTFGTSQGISGTTDDPLYQTERYNANLAYEIPVADGEYQVTLEFAEL
YHNSAGNRVFDVLAEGQLFVDDLDIYAQVGKNAAYTETFTIPVNDGVLDLSFVASADQAK
VSAIAIAPVGDLPPQVPTTSGISDVSVVEGEVNSVVDLFAAFDDFEDADVDLVYSIVNNS
DPTLFDDAAINPTTGELTLTYAATVVVGSSALTIRATDTDGLFVETSFNVAVTEDNSGGP
VNPPTILINAGGNSYTDSLNQQWSADQYSTGGKTFSGSNAIYNTDDPTLYQTERYGGDFA
YEIPVANGEYQVSLEFAEIYHNSAGNRVFDVLAEGQLFVDDLDIYAQVGKDAAYTETFMI
PVNDGVLDLSFVASADNAKVSAIAIAPVGDLPPQVPTTSGISDLSVVEGEVNSVVDLFAA
FDDFEDADVDLVYSIENNSDPTLFDDAAINPTTGELTLTYAATAVVGTSALTIRATDTDG
LFVETSFNVAVTEDNSGGGGNPGNPNALLINAGGGAYTDILNQEWVADQDFVNGKTFSTS
GDIGGTVDDPLYQTERYDANLAYTIPLVDGEYQVSLEFAELYHNSAGNRVFDVSAEGQLF
VDDLDIYAQVGKNAAYSQTFNVSINDGALDLDFVASADAAKVSAIAITPIEPPPGIRVNV
GGSEYTDEFGKVWAEDSFNSGTSSIYTTTATISNTTADELFQSGRSGSNFAYAIPVDNVG
TYNVNLNFAETIFNAPGQREFTVLVEGQVLRSDLDVWQQSGGAKDQALIEFMTQVPVSDG
VLDIQLTASQGEATIAAIEVVEVSPDLLPELFVEMDVPTTLVDYDGDGVVVVNVRGSESQ
AREFGEVLTEWTWTRDGSTVIERGNNIADADISTTLGLGQHQLSLTIQDSQDPPAVLTGD
AIVNIYPVNQVSGTFARYYSGADAPIATLLDSVTALPDLTDVDHVEALPGMAVSESASTL
GSSPFNSDVVVAMDGEFTATTTGSYDFVLQGGSDRQFYIDFDLDGDLDQVNPNDIQLTQG
QTYSLQSRFAFDNTAPLMAEVLVAIDDATPTTFVPGSLSHDQSSLLPFINNVPTQAQPAT
VPAFGGTVTLNGFGFFDTTGANPVKVIWDGVELDPADYTLTDGNKIQIQAPPTPGGTVVP
VIIETANGQSNTAYVSYSFDNVPIEFTTTAIAGTDSFGPTQATWGPDGRLYVASIAGQIK
AYTFDDDYNVTATEEINAIAGLTNANILGIAFDPFADHNDPQLYVAHSQLFVNGGAEIPD
GEFSPYTGQVSLLSGANFANLDPVITNLPTSNHDHGVNGLTFDDSGNLLIAQGGNTNAGV
KWPQIGDLPESPLAAAILIADVNAPDFNGNIQYEWAGAAPSPDADPTNQVYGDLVTVVPG
VDISIYATGLRNAFDLVWTIDGRLYATDNGANSGFGPTPEGQNVNVDDEVNLILPGAYYG
HPNPSRSENIYFSTNEPSIPGIYEAPLAIVDASTNGITEYRATTFNGEMRGNILAQDWNE
TLYSFGVAPDGTFDSTTEFTDLSTALDVITGPGGVIIGVDYSDDNLTVSKPIDAAAVGVT
AYDIYPWRSPSAGGAPFVIGGANFSGDVGNTTVTIGGVEVTITSVSGNRIEGVLPSLGSA
GLKDIVVNSGGQVSTITNGFRALA
Download sequence
Identical sequences K9SFS5
gi|428216769|ref|YP_007101234.1| WP_015163780.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]