SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428216790|ref|YP_007101255.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428216790|ref|YP_007101255.1|
Domain Number 1 Region: 1033-1156
Classification Level Classification E-value
Superfamily OmpA-like 1.96e-19
Family OmpA-like 0.0056
Further Details:      
 
Weak hits

Sequence:  gi|428216790|ref|YP_007101255.1|
Domain Number - Region: 743-836
Classification Level Classification E-value
Superfamily Roadblock/LC7 domain 0.0942
Family Roadblock/LC7 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428216790|ref|YP_007101255.1|
Sequence length 1162
Comment transport-associated protein [Pseudanabaena sp. PCC 7367]
Sequence
MTSPNSNPDPGNPSRHGDRLHSINPQANDANDANDPEDINPLSGLIGTLSDLQVVKMQQR
QRANPGQISPMPAPELNADSVEFSQPQPGDRDFQLDQASNELDEPLEPNQRKQKAHPYTN
LVKRFRANSNQVRPTAQASQHPALTTEPEQPNPFESDNLDSLADLDNLGEQSNGNLPEIV
YQPNYDRSESVHPQENSPLGLEDLEALGDLDDLGAIDHLDHDQDSTPNAPTTPATPVSDS
AKPIEPTQSNSTHASTDSLASGALDALFQDLDLGSAQTGFEFDNNPTNQNDQNNAQITDQ
LTDQLSNELDDLLNGLNSLGNSLGAASISELKIEPEAGDRPPANSPDQNQAQNQVRTSSL
IGDQNINNPPINKQPKPGTAGGATAQPLLNEAGEPIGLLRDLLGSAAEDEVSLIEQRLAQ
ITNKVEQLDYQINTPPDTSQIDGQFANIGGQLAEIDGQFANLENQLESRLATLQNTIQNH
PKIIELDGRLGDLQSVVADRSALEALDRQVELINQEIAQIADIKLLKQQLESLSQNVYQR
QDIDMVMQKLLEVLRQHGNYPKRLALLKRRLVHLEQRINEPQELIELLLPIVNELLRRKI
SMARDEFAKSLATVVDEMIHDKIEEDREAMSIAIAPILAEAIIHRSIAAPGEFASAIAPE
LDVAIREQIKNNANSMVDALYPIIGNTIAKYMVEAIRVINEKIENAFSPEGIMRKIRAKA
QGVSEAELIFQSAMPSVVRAAFLIHKESGLVIAETQPDGEQQLESDMLGGMLTAIRSFVN
DWVSTSEHNSELDEIDYGRSKIMLEVAGFCYLAVVVEGESGRSQIAKKMRQVMATIIQKY
SRLIENFEGDPTTIPRQVKKTLDQLLDKPATEENFRSPLYGIGILILLLLGLATIPWWFT
WRRAKAVKAVDQALDNAPALSVYNLDAEIKGGELALTGRVPTEYLRAQAEDVATQALLTS
TTQTRFELVNNIVAVEVPPDPTVVAQEVERTAASLNQFEAIAITVEFNASEVNLAGTIGT
AEQAQLISQSFAQIPGVTKVVTSLQVVVPEIPTLTTKIFFALGDSTITTAEDPKIAQVKN
FLVKYPNYKLRIIGSSDPVGSLANNEQLAWDRAETVKNALIAQAIDPQRLTTAAVALGSL
NRGDQPSWLDRRVEFEVIAPSE
Download sequence
Identical sequences K9SE02
WP_015163801.1.5078 gi|428216790|ref|YP_007101255.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]