SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428216875|ref|YP_007101340.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428216875|ref|YP_007101340.1|
Domain Number 1 Region: 204-229,264-417
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 6.4e-28
Family Actin/HSP70 0.0016
Further Details:      
 
Domain Number 2 Region: 3-171
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.44e-24
Family Actin/HSP70 0.0058
Further Details:      
 
Weak hits

Sequence:  gi|428216875|ref|YP_007101340.1|
Domain Number - Region: 421-490
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.011
Family H-NOX domain 0.02
Further Details:      
 
Domain Number - Region: 522-555
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 0.0589
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428216875|ref|YP_007101340.1|
Sequence length 568
Comment heat shock protein HSP70 [Pseudanabaena sp. PCC 7367]
Sequence
MHYAIDFGTSNTVVARINAEGVAETIALPGLSSTIANNPPLIPSFVYVENAQDGKVLVGQ
EVRDRGLDLKGNQKEPRFFHSFKRAIGANLPGFVPELDEVEVSFESVGNWFLKRIIAQLE
EPESIVFTVPVDSFEPYRQWLSDVSAELAVKQIRLLDEPTAAALGYGLGKKESEQERDSE
PNTPNPLNPLNPNEGKEAAVSISDRQTILVVDFGGGTLDLALVKLNLPQLQVESENKPQS
AGLLGFLLKWGDTPVKITQKPQTARVIAKAGQNLGGMDIDNWLVDYFHRQQGLPKNSLIS
RLAERVKITLSTEESASEVFFDDVSFNSYELNLERSQLNQVLAENQFFDRLDASLNQIKQ
QATRQGFDLATEIEAVLLVGGTAQMPAVRDWAVKHFSAAQVKAHKPFEAIAHGALAQEWQ
LKDFLYHSYGVRYWDKRHKRHGWQPIVQAGQTYPLEKPIELVLGASRPEQPSIELVIGEL
GETDVEVYFEGDRLVTRNLSESKQAVQPLNDRDAGSRSIANLEPPGNPGSDRIKVLFQVD
EQRTLKITVEDLLTNDLLVDEQAVVQLI
Download sequence
Identical sequences K9SE76
WP_015163886.1.5078 gi|428216875|ref|YP_007101340.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]