SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428216925|ref|YP_007101390.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428216925|ref|YP_007101390.1|
Domain Number 1 Region: 8-154
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 7.06e-31
Family Phosphoglucomutase, first 3 domains 0.00045
Further Details:      
 
Domain Number 2 Region: 180-282
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.02e-25
Family Phosphoglucomutase, first 3 domains 0.00063
Further Details:      
 
Domain Number 3 Region: 285-400
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.92e-16
Family Phosphoglucomutase, first 3 domains 0.0013
Further Details:      
 
Weak hits

Sequence:  gi|428216925|ref|YP_007101390.1|
Domain Number - Region: 445-494
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.00575
Family Phosphoglucomutase, C-terminal domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428216925|ref|YP_007101390.1|
Sequence length 513
Comment phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Pseudanabaena sp. PCC 7367]
Sequence
MMQDFDWKKLQNGSDIRGIALEGVADESVNLTSEVARKLGQAFATWLAAKVNKPIDKLLI
SVGRDSRLSGPDLMQATIAGINSMGAQVYDFDLASTPAMFMSTVTIGFSCEGAIMLTASH
LPFNRNGMKFFTAQGGLNKQDITDILALAAANKFELANAPGKATKRDFISVYADQFVTKI
RNAVNHPKHFKQPLQGLKIIVDAGNGAGGFYADKVLKTLGADTTGSQFLDPDGTFPNHVP
NPENKVAMASICDAVVKHQADFGIIFDTDVDRSAAVDGQGNELNRNRLIALIAAIVINEH
PGSTIVTDSITSDGLTKFIEQDLGGKHHRFKRGYKNVINEAVRLNEAGQESWLAIETSGH
AAMKENYFLDDGAYLVSKLLIELAKAKLAGKSLTDLIANLKEPVESSEFRLKIGVDDFKT
HGQQVIDKLTAFATEQSDWQIVPNNYEGIRVACPADNEDGWFLLRLSLHDPVIPLNIESN
VAGGVNAIAARLLTFFATTDALDLAPLTKKFTG
Download sequence
Identical sequences K9SEC0
gi|428216925|ref|YP_007101390.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]