SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428216959|ref|YP_007101424.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428216959|ref|YP_007101424.1|
Domain Number 1 Region: 226-324
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.00000000000000628
Family Pollen allergen PHL P 1 N-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428216959|ref|YP_007101424.1|
Sequence length 333
Comment rare lipoprotein A [Pseudanabaena sp. PCC 7367]
Sequence
MLLSLLSVAYLDIALATDTVQADEIKAQTKAEQSTTKVSSAVKIGETRSQSMARLQADAI
AKVYPHKMQESAAATVQVSNIPVLTFLGTSKVADASNALQVDSQSASKSVKLPSLADEPI
EVIVDSSDPVKRATAIAAMINQLHMEGIDPEKIVPAYENGRYVIKLGDDQVIEFDQNVLL
PDTTNNRQQDVLQAANRLRRLMGGAAPVNTVAGAPKPKKPTIAANLISRVARTDTGMASW
YGPGFNGRQSASGEIFNQNALTAAHRTLPFGTKVKVTNVHNGQSVVVRINDRGPFSGGRI
IDLSKAAAGAIGLIRSGVAPVKVEVLVRDALGR
Download sequence
Identical sequences K9SG85
gi|428216959|ref|YP_007101424.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]