SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428217007|ref|YP_007101472.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428217007|ref|YP_007101472.1|
Domain Number 1 Region: 298-449
Classification Level Classification E-value
Superfamily beta-Roll 6.8e-28
Family Serralysin-like metalloprotease, C-terminal domain 0.00038
Further Details:      
 
Domain Number 2 Region: 121-232
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000536
Family Collagen-binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428217007|ref|YP_007101472.1|
Sequence length 499
Comment peptidase domain-containing protein [Pseudanabaena sp. PCC 7367]
Sequence
MSGFDQSLTLVPGASQTIIIPSSILTVGQSASVTVLSADITGEDFSPFIEVLNPDGSVLT
NGVATLDSDVQPNTFTRTINIPSVVDGGSYQVVISDSRDGDNPNPATRFTVEVDSELGTF
NNQANENTPEIGSDRSFAGWVGATDPDDFYQIPLTATGTIEASLSSVSADADIELLADDG
TTVLATGGEDDSITFDVMDADSTFFIRVFRAAEELPGDASDEGNGSTTYTLDLTIPESPQ
ETPVTITPPTTTTESPNEPTGLDNIVGGGFFNFTDGDDNVNLADVPESAGISIRALSGND
LIIGTDGNEFDINGNQGNDTIEAGDGNDAVMRGGKGSDSIDGGSGNDILNGNNDNDTVVG
GNGDDTIRGGMDNDILLGGSGNDFLIGDLGQDILTGEGGSDVFVLRSDGGAAASTLAEAD
VVTDFSNVFDRIGLSGGTNFSDLTFEAVNLTLGADTPVAATAIRVGTDGDYLGIVAGIDI
ATLDNASLFIDASGQLNFG
Download sequence
Identical sequences K9SGX6
WP_015164018.1.5078 gi|428217007|ref|YP_007101472.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]