SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428217047|ref|YP_007101512.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428217047|ref|YP_007101512.1|
Domain Number 1 Region: 79-303
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.93e-46
Family RecA protein-like (ATPase-domain) 0.0086
Further Details:      
 
Domain Number 2 Region: 267-281,315-464
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.53e-33
Family ATP-dependent protease Lon (La), catalytic domain 0.0079
Further Details:      
 
Weak hits

Sequence:  gi|428217047|ref|YP_007101512.1|
Domain Number - Region: 5-33
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0541
Family Rubredoxin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428217047|ref|YP_007101512.1|
Sequence length 484
Comment DNA repair protein RadA [Pseudanabaena sp. PCC 7367]
Sequence
MAKSKSKYVCNSCGSEYAQMYGRCPDCGTWESLQEQVVEVATTGTNRLAKLPTSKQKAGK
NFQPKPRKSLTLLQIGDDNQQRLGSGYGELDRVLGGGIVPGSLVLIGGEPGIGKSTLLLG
MAQQLIAKEPVLYVCAEESAQQVKLRSQRLGLDPQAADNLYLIPETDLESIVQELYAIRP
TVAIVDSIQALYFASLTSAPGSVAQVRECTSALMRVAKRENINLFIVGHVTKEGAIAGPK
VLEHLVDTVLYFEGDRFASHRLLRSVKNRFGAAQEIGVFEMAERGLLEVENPSELFLGNR
EEPAPGTATIVACEGTRPLVVELQSLVSPTSYSSPRRTTTGIENNRFLQILAVLEKRIGI
PLSKLDAYVASAGGLNVAEPAADLGVAIAVAASFRDRIVDPRTVLIGEVGLGGQVRAVSQ
LEIRLKEAAKLGFKKAIIPNTQTTQNYGLELIPVNKVMDAIVAALPRVPAIDNADPDLQK
LEDS
Download sequence
Identical sequences K9SH14
WP_015164058.1.5078 gi|428217047|ref|YP_007101512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]