SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428217049|ref|YP_007101514.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428217049|ref|YP_007101514.1|
Domain Number 1 Region: 170-446
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.26e-120
Family Enolase 0.0000000409
Further Details:      
 
Domain Number 2 Region: 33-167
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.01e-53
Family Enolase N-terminal domain-like 0.00000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428217049|ref|YP_007101514.1|
Sequence length 455
Comment enolase [Pseudanabaena sp. PCC 7367]
Sequence
MRIPPGKLAIQPGDRNLSSLRKKETAKVSKSTEITAIVAREILDSRGRPTIEAEVHLAGG
AIGLAQVPSGASTGSFEAHELRDDEKSRYGGKGVLKAVRNVSEKIVPLLTGMDALNQDQI
DMAMIERDGSANKSNLGANAILGVSLATAKAAANALNLPLYRYLGSPTSNILPVPMMNVL
NGGAHADNNVDIQEFMIVPVGAPSFKEALRYGAEVFATLKKVLHDKNLNTSVGDEGGFAP
NLESNQAALDLLVDAIAKAGYKPGEQIALALDVASNELYTDGDYSFDGKSHTASEAIAYY
EKLIGQYPIVSIEDGLEEEDWANWQLLTQKLGSIQLVGDDLFVTNQKRLDRGILENCANS
ILIKLNQIGSITETLETINTATRNGYSSVISHRSGETEDTTIADLSVATRAGQIKTGSLC
RSERVAKYNRLLRIESELGDRAVYAGSIGMGPKVK
Download sequence
Identical sequences K9SGH3
gi|428217049|ref|YP_007101514.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]