SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428217132|ref|YP_007101597.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428217132|ref|YP_007101597.1|
Domain Number 1 Region: 40-191
Classification Level Classification E-value
Superfamily Prim-pol domain 0.00000000785
Family Bifunctional DNA primase/polymerase N-terminal domain 0.008
Further Details:      
 
Weak hits

Sequence:  gi|428217132|ref|YP_007101597.1|
Domain Number - Region: 479-618
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00591
Family Nucleotide and nucleoside kinases 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428217132|ref|YP_007101597.1|
Sequence length 741
Comment virulence-associated E family protein [Pseudanabaena sp. PCC 7367]
Sequence
MIKASTLAEERPRSDANTKPSTIRPEISKIIAELQFLSLPALPVAPGHKNPSFINSAGEI
ENIKHSEYHDRMPTEDELREWFSHADVGIGALGSIRYRWLDLDAKHFDSPDKCEAAFKEL
IPNYENYWVERTQSGGCRVLVDCGDNPPDFTNFSLSPDGEHVGELIGVGRFAVLAPTVGQ
NGRYEKITDSYEPILFDELEIYQYSGKTGKSKQIDNVKSSNLVDLDNQNNEPEKLISHAS
INISGNSRVVPLIEIISENAKKVIAGVDISNDRSGSLAALLNELVGWQNFCHRHGIPHSN
DLSYLAHEAGSKLGIDSDRINRIIKTIDPSCMPSCHYQGGDDACWTKLNKYGYYPKLYDD
ASPTSTRSNSSELAKNYAEIEYALSGRLRYNELKSAIELDGQLFEEDSARLWLANTLGVT
LSQSDAWNSITSIAKNNSYHPVQEYFNLLATEDIDPDQVINGLAVKLFGVVDPIYYIYLK
RWLIGVVARVFDPGCKMDTILILQGKEGLGKSMLFAKMCKYPEWFCDDMGSIKDKDQLLK
MHHALITEWSEADSLLAKNDSSSMKAFVSCREDNIRKPYARESKLYKRRGVIVGTTNRSD
FLGDEATGDRRFWVIPIEKPIDLEFVRANRDLIWAAAVKFYRQGEQWWLTSEEQQLSHEF
NSGYRAVHPWLHEVDKFVADKTELTQSDLDRCLKRIKEETGTHTPQDVKAIRKCIRNLGF
SSKNRRVDGKQQTVWVKEVEP
Download sequence
Identical sequences K9SHA4
WP_015164143.1.5078 gi|428217132|ref|YP_007101597.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]