SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428217139|ref|YP_007101604.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428217139|ref|YP_007101604.1|
Domain Number - Region: 50-82
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00224
Family Rho termination factor, N-terminal domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428217139|ref|YP_007101604.1|
Sequence length 84
Comment hypothetical protein Pse7367_0876 [Pseudanabaena sp. PCC 7367]
Sequence
MSEIKHYREFLLNQEREVFLAGMRGQIPLEQAMHQLAETKSALASLRDRLVMLNIRQLKQ
LAVGSGIRYYSRLRKAELIEALAG
Download sequence
Identical sequences K9SGR2
WP_015164150.1.5078 gi|428217139|ref|YP_007101604.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]