SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428217240|ref|YP_007101705.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428217240|ref|YP_007101705.1|
Domain Number 1 Region: 79-425
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.45e-72
Family Extended AAA-ATPase domain 0.0000000114
Further Details:      
 
Domain Number 2 Region: 9-44
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000171
Family ClpX chaperone zinc binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428217240|ref|YP_007101705.1|
Sequence length 444
Comment ATP-dependent Clp protease ATP-binding subunit ClpX [Pseudanabaena sp. PCC 7367]
Sequence
MPSKYDSHLKCSFCGKSQEQVRKLIAGPGVYICDECVDLCNEILDEELFNGTSAQATQRR
EAQPEKRKAKSIKGRSLSQIPKPRDIKRYLDEHVIGQDEAKKVLSVAVYNHYKRLSVLDE
EGQTPEDAIELQKSNILLIGPTGCGKTLLAQTLAEILDVPFAVADATTLTEAGYVGEDVE
NILLRLLQVADLDVEEAQRGIIYIDEIDKIARKSENTSITRDVSGEGVQQALLKMLEGTV
ANVPPQGGRKHPYQDCIQIDTKNILFICGGAFVGLDKAVEQRVGKKSMGFIQQMEAMPKE
KRTANMLKQVQPEDLVKFGMIPEFIGRVPILAGVEPLDENTLISILTEPRNALVKQYQKL
LGMDNVELEFASDAITAIAKEAYRRKTGARSLRGIVEQLMLDLMYELPSRKDVRRCTITG
EMVEKLSSAEVLLHPSSLPKTETA
Download sequence
Identical sequences K9SF99
WP_015164250.1.5078 gi|428217240|ref|YP_007101705.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]