SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428217638|ref|YP_007102103.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428217638|ref|YP_007102103.1|
Domain Number - Region: 63-90
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0706
Family MesJ substrate recognition domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428217638|ref|YP_007102103.1|
Sequence length 100
Comment hypothetical protein Pse7367_1383 [Pseudanabaena sp. PCC 7367]
Sequence
MGRIDACSYCQFFARSQHLVCALHPSGPDGISCADFSPTEAEQQMREPIKNLFDRGELQN
RPVTSQDKAYIDIKKLNQLPLDLRIRVLRWGVRVRRPWRM
Download sequence
Identical sequences K9SHP4
WP_015164648.1.5078 gi|428217638|ref|YP_007102103.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]