SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428217648|ref|YP_007102113.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428217648|ref|YP_007102113.1|
Domain Number 1 Region: 40-154
Classification Level Classification E-value
Superfamily Formyltransferase 2.62e-22
Family Formyltransferase 0.0000401
Further Details:      
 
Domain Number 2 Region: 167-225
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 0.00000000000000267
Family Post formyltransferase domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428217648|ref|YP_007102113.1|
Sequence length 230
Comment methionyl-tRNA formyltransferase [Pseudanabaena sp. PCC 7367]
Sequence
MAPNSINYLVAGSKPWNRQVFDQVITKLPGNWHFLSDSAELTPAMVSTLAPRYIFFLHWS
WLVPSEIVNQYECVCFHMTDVPYGRGGSPLQNLIVRGHQTTKMTALRMTKELDAGPVYFK
TELSLAGNAEEIYIRATYLCADMIERLIKEKPQPLSQQGEAVIFKRRQPADSEIPELKNL
AAVHDFIRMLDAQGYPKAFIESQGFRYEFSQATIYDGRVVAHVVITPVNS
Download sequence
Identical sequences K9SHQ4
gi|428217648|ref|YP_007102113.1| WP_015164656.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]