SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428217740|ref|YP_007102205.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428217740|ref|YP_007102205.1|
Domain Number 1 Region: 39-170
Classification Level Classification E-value
Superfamily RNase III domain-like 2.09e-32
Family RNase III catalytic domain-like 0.00079
Further Details:      
 
Domain Number 2 Region: 134-263
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000000000347
Family Double-stranded RNA-binding domain (dsRBD) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428217740|ref|YP_007102205.1|
Sequence length 269
Comment RNAse III [Pseudanabaena sp. PCC 7367]
Sequence
MTSPSSDRFALAPSRQRDLDSLIARLGIATKGETKHSKRSPINWLLLDQALIHATFDREH
NYEKLEFFGDSVLRLAVALFLRQHYHDRPLGDLAALRSYLVSDEALAEIADRYGLDRFLV
MSSSLRDDPKAKRSRLADATEAILGALYLSTNDLSLISPWLDLHLHRIAQQLLQQPSMGN
YKAALQELTQAHWKMLPEYRSVAVRPNHTANANVDGARQNSKKPQKELFAAEVWFQDKCW
GYGEGSSIKAAQQVAAEYAYAALLPTIKN
Download sequence
Identical sequences K9SGQ9
WP_015164746.1.5078 gi|428217740|ref|YP_007102205.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]