SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428217800|ref|YP_007102265.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428217800|ref|YP_007102265.1|
Domain Number 1 Region: 4-465
Classification Level Classification E-value
Superfamily ADC synthase 5.36e-132
Family ADC synthase 0.00000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428217800|ref|YP_007102265.1|
Sequence length 468
Comment para-aminobenzoate synthase component I [Pseudanabaena sp. PCC 7367]
Sequence
MTAWLWQKHSLPDHVSTAQIWEVLFGHESIAVLLESPKANSNHSSLTHGKTARYSIAAGS
PKEYFTPELGQILPCLKELQAKVRHEYDLEGKLLPDEILELPFIGGYLGWLGYDLAWEIE
KLPYLKPDVLPFPVAFWYAPRNFAIIDNWQKQVWLAAIDQAELTKMGDRITELVQRGLKK
NDSLISLSHTSTSALKIDFLSDAAAYEAMVRKAKAHIKAGDIFQANLSLRFGVDWPGDGW
QLYQKLQWINPSPFASYWRTPWGEMISVSPERLVKLTEQRAETRPIAGTRPRGDDAQSDL
AYEQEMLASTKERAEHIMLVDLERNDLGRVCKWGSVQVDELLVVERYSHVMHLVSNVIGE
LSSDRDGIDLIRATFPGGTITGCPKVRCMEIIEELEPCRRSLFYGSCGYLDRRGNLDLNI
LIRTLLKCDDRIWGQVGAGIVADSEPDREWLESLQKAKAQLAALDLLI
Download sequence
Identical sequences K9SGW3
WP_015164806.1.5078 gi|428217800|ref|YP_007102265.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]