SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428217867|ref|YP_007102332.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428217867|ref|YP_007102332.1|
Domain Number 1 Region: 7-269
Classification Level Classification E-value
Superfamily Pentein 1.71e-52
Family Dimethylarginine dimethylaminohydrolase DDAH 0.03
Further Details:      
 
Weak hits

Sequence:  gi|428217867|ref|YP_007102332.1|
Domain Number - Region: 601-696
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.00118
Family Pyruvate oxidase and decarboxylase, middle domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428217867|ref|YP_007102332.1|
Sequence length 701
Comment hypothetical protein Pse7367_1615 [Pseudanabaena sp. PCC 7367]
Sequence
MSADISFLMCSPEHYDVDYVINPWMEGNVHRSSFDKAREQWHSLYGILKDLATVKLVEPA
KGWPDMVFTANAGLILGNNVVLSRFMHKERQGEEPHFKAWFESQGCHVFELPQDLPFEGA
GDALLDREGRWLWAGYGFRSELDSHPYITKWLDIEVLSLRLVDGRFYHLDTCFCPLTGGY
LLYYPGAFDAYSNHIIEMRVPAAKRIAIDEADAVNFACNAVNVGQNVIMNKASDRLKARM
TEAGFKVIETPLTEFLKAGGAAKCLTLRITEPIAPLKKEAIALESRVVEMSGHLLDSGIV
SRALDLVVENGGSFQVLDFKLGIQKNSTSNAQIKVSAPSHDKMSDIMSQLIDMGAAIPEQ
DASDAILEVVTKAGVAPDDFYVTNIYPTDVRVGGEWIRCDAQRMDGAIVVDAAAKSAQCK
LLRDLQEGDRVVVGVDGIRTLVRPKDQDKKQKEEFSFMGAGVSSERRVELVVEQIAWELR
QIRDRGGKVMVTAGPVVVHTGGAPHLAYLIREGYVHGLLGGNAIAVHDIEQAVMGTSLGV
DLQRGVSVHGGHRHHLKVINMVRRYGSIDAAVKAGAIPSGIMYECVQNKVPYVLAGSIRD
DGPLPDTHMDLIAAQQHYAEQIKGTDMILMLSTMLHSIGVGNMTPAGVRMVCVDINPAVV
TKLSDRGSVESVGVVTDVGLFLSLLVKQIQKLTVPFGQVSA
Download sequence
Identical sequences K9SJD9
gi|428217867|ref|YP_007102332.1| WP_015164873.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]