SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428217881|ref|YP_007102346.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428217881|ref|YP_007102346.1|
Domain Number 1 Region: 248-490
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.3e-63
Family Leukotriene A4 hydrolase catalytic domain 0.0015
Further Details:      
 
Domain Number 2 Region: 43-241
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 1.83e-46
Family Leukotriene A4 hydrolase N-terminal domain 0.0006
Further Details:      
 
Domain Number 3 Region: 600-900
Classification Level Classification E-value
Superfamily ARM repeat 3.99e-29
Family PBS lyase HEAT-like repeat 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428217881|ref|YP_007102346.1|
Sequence length 924
Comment Peptidase M1 membrane alanine aminopeptidase [Pseudanabaena sp. PCC 7367]
Sequence
MGKAHLADKLDDQVLGTVGEAIGLDTDQAKKKKHKSFQLPGAKPHYNPDRPGQVEHIALD
LELDIPNRSISGTCQIRLNPIRNGVSTLTLDAVGLQIKKVAIGKQAQTYDYDGEFLTVKL
TEPTSAGKPITLAIDYAVIQPQRGIYFILPTEHEPNKPTQVWTQGEDEDSRFWFPCFDYP
GQLSTSEIKVKVPENLFAISNGELVNTEANKANKAKGKTKTYHWHQKQVHPTYLMTLAVG
DFLEIKDEWRGKQVTYYVDKSVSKEDALRTMGKTPQMLEFLSEKYGYEYAFPKYAQVCVA
DFIFGGMENTSTTLLTDRCIIDERAAIDDSRAESLVVHELAHQWFGDLVVIKHWSHAWIK
EGAATYSEVMWTEKEYGADEAAYYRLGEARSYFAEDAERYRRPIVTHIYREAIELYDRHL
YEKAGAVYHMLRTELGEELFWRAIHTFVQTNAHKTVETIDLLRAIEMATGKNCLALFDQY
VFRGGHPEYKLSYSWDDQNKLAKVTVNQTQDELFDLKLPIAFGMIPETHKDKATKTTRSK
GKKTKAASKAVSTEANPNLAVELKTFTVRIFEKEQSFYFPLDRKPGFISFDHQNNYLKTV
SLEYNLAELKAGLNYNPDPLARIQAAEAIAKKGSLEAVNALEQALISDPFWGVRVEVAAA
LAKINLEQATAALAKGLADENAKVRRAVINALAKTKTPEVLDLIKPFLKKGDPSYRVEAT
AASCLGTIAAALSPDTNNTKPDKIIKLLQITLKEKAGWNEVVRSGAIAGLAKLKDSDQAL
ALVSQYTAPDVPQPLRLSAIRALGAMGKSQTKPKTTQILNRLQIIAKESFFLTQVAVVGA
LAQIDSPAAIRVLREIADQSPDARVKRRAEEAIQKVQKAIGKDAGLKELRDELEQLKKDN
QKLRSRLEAIEAKTNSKNSDTSVT
Download sequence
Identical sequences K9SI92
WP_015164887.1.5078 gi|428217881|ref|YP_007102346.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]