SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428218105|ref|YP_007102570.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218105|ref|YP_007102570.1|
Domain Number 1 Region: 27-211
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 1.41e-19
Family gamma-carbonic anhydrase-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428218105|ref|YP_007102570.1|
Sequence length 221
Comment hypothetical protein Pse7367_1866 [Pseudanabaena sp. PCC 7367]
Sequence
MRNLIMAISFFFPWFMRRWILNTFLGFEIHPTSRIGLAWVLPRRLIMEAHTSIGHLTVCK
NLELIHMHEYAVIGRGNWITGFPPIESKHFAHLPDRQPQLIMGEHSAVTNRHLIDCTSKV
TIGKFATFAGFRSQIMTHSVDIEKGRQTAAPVSIGDYSFVGTDCVILGGSTLPNYSVMGA
KSLLNKEYEESHHLYVGIPARPVKALPQDYQYFCRETGFIY
Download sequence
Identical sequences K9SHQ2
WP_015165108.1.5078 gi|428218105|ref|YP_007102570.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]