SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428218119|ref|YP_007102584.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218119|ref|YP_007102584.1|
Domain Number 1 Region: 3-243
Classification Level Classification E-value
Superfamily Hsp33 domain 3.01e-64
Family Hsp33 domain 0.00000192
Further Details:      
 
Domain Number 2 Region: 234-293
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 1.96e-18
Family HSP33 redox switch-like 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428218119|ref|YP_007102584.1|
Sequence length 300
Comment 33 kDa chaperonin [Pseudanabaena sp. PCC 7367]
Sequence
MADQLIKATAADGGIRAVAAITTNLTNEAMRRHGLSMVATAALGRTMTAGLILASSMKKP
GARVNMRLSGDGPLGVVFADAGLDGTVRGYVGNPKLELPPNKQGKLDVGGAVGRNGFLYV
LRDTGHEFPYSSTVELVSGEVGEDVTYYLASSEQTPSALLLGVFLDQTGVAAAGGLLLQI
MPKAARDDSLIEVLEERVSKLTGFTPLLRSGQKLPQILKQMLGDQGLQIFPETQMLNFHC
PCTFERVLGALRMFGEEELEDMIDKDGGAEATCNFCAEVYQADRHHLRMIINNLQREAQA
Download sequence
Identical sequences K9SJJ8
WP_015165122.1.5078 gi|428218119|ref|YP_007102584.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]