SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428218169|ref|YP_007102634.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218169|ref|YP_007102634.1|
Domain Number 1 Region: 4-316
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.46e-99
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000023
Further Details:      
 
Domain Number 2 Region: 342-484
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 3.66e-31
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428218169|ref|YP_007102634.1|
Sequence length 485
Comment cysteinyl-tRNA synthetase [Pseudanabaena sp. PCC 7367]
Sequence
MSQQVYNSLTRQKEELQTLEPGQIKMYVCGVTVYDFCHLGHARAYVVWDMVRRYLQSRNY
QVRYVQNITDIDDKILKRAQQEGVTMQEISDRYIATYNEDMARLNIMPADEYPRATESIE
AIIDLIKALEAQDYAYAAGGDVYYAVQKFPTYGKLSGRKLADMQAGASGRVAVGEELKRY
PFDFALWKAAKPGEPFWQSPWGEGRPGWHIECSAMVRSRLGDQIDIHAGGADLQFPHHEN
EIAQSEGATHQPLARYWLHNGFVNIDGEKMSKSLGNFTTIRELLKHYDPMAIRLFILQSH
YRQPIDFTEEAINAATRGWETIRDGLLFKHDFGDQLGWDRLAVALDQLDQNLLDRFHGAM
DDDFNTSIAISLLFELAKPLKAEANKLVHSGKSDLASAVLAQTWQTLSYLSDVLGFIADP
EARSNANHSNDSATVSDDQIETMVQQRCAARKAKDFAASDRLRDQLKELGITLIDQPDGT
TRWHR
Download sequence
Identical sequences K9SJQ5
WP_015165172.1.5078 gi|428218169|ref|YP_007102634.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]