SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428218184|ref|YP_007102649.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218184|ref|YP_007102649.1|
Domain Number 1 Region: 138-359
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.27e-51
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000103
Further Details:      
 
Domain Number 2 Region: 443-579
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.62e-36
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000579
Further Details:      
 
Domain Number 3 Region: 2-137
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.93e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.0075
Further Details:      
 
Domain Number 4 Region: 360-436
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.62e-17
Family Duplicated SiR/NiR-like domains 1 and 3 0.003
Further Details:      
 
Domain Number 5 Region: 588-635
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0000834
Family CopG-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428218184|ref|YP_007102649.1|
Sequence length 636
Comment sulfite reductase (ferredoxin) [Pseudanabaena sp. PCC 7367]
Sequence
MTNTMKRSKLESIKERSNFLRGPIDAELNNDDPFFSKDGIQILKFHGSYQQKDRDLQKAK
AKGEAPTYSMMLRTRSPGGIIPWQLYLTLDQLCDRYGNHTLRATTRQGFQMHGILKQDLK
TVIADIVKNMGSTVGACGDINRNVMAPPAPFKDRPAYVYAHEYAHKLADLLAPQAGAYYD
VWLDGEKAVTAEAPEVTEARNKSGRGKRDTNIANSDEPIYGTHYMPRKFKIAIATPGDNS
VDLFTNDLGLVVITDKKHKLLGFNAYVGGGLGRTHNNESTIVRMADPIAFVPLAHVYEFT
KAVVAVQRDNGDRFNRRHARLKYLLNDWGVEKFKQVLSEYYPERLEPLKPLPKWQYLDYL
GWHEQGDGNYFVGISIENGRILDREGLKLKSALQEIIGEYHLPMHLTPNHNALLCDIKPK
DREAIQAILDRNGILAPEQVDPLVRYSMACPAFPTCGLAITESERILPSVTDRLRKLIDR
LGLGEEKFITRMTGCPNGCARPYMAEIGFVGSGVDAYQLWLGGNFDSTQLAAPYLKSMPL
AELETTLEPLFVYFKQARKPKEGFGSFCARVGFDGLRSFTASYVPQKASKAGKSKDQRRR
VTLSTDTYDRLKQAASSRGQSMKQIVETAIAKYLDS
Download sequence
Identical sequences K9SJS2
gi|428218184|ref|YP_007102649.1| WP_015165185.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]