SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428218198|ref|YP_007102663.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218198|ref|YP_007102663.1|
Domain Number 1 Region: 188-359
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 6.2e-64
Family Pyruvate oxidase and decarboxylase, middle domain 0.00004
Further Details:      
 
Domain Number 2 Region: 2-178
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.73e-64
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000349
Further Details:      
 
Domain Number 3 Region: 368-566
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.4e-63
Family Pyruvate oxidase and decarboxylase PP module 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428218198|ref|YP_007102663.1|
Sequence length 592
Comment acetolactate synthase large subunit [Pseudanabaena sp. PCC 7367]
Sequence
MQTTGAFALVDSLVKQGVEHIFGYPGGAILPVYDEIYKAEERDEITHILVRHEQGAVHAA
DGYARATGKVGVCVATSGPGATNLVTGIATAQMDSVPMVVITGQVPSYAIGSDAFQETDI
FGITLPIVKHSYVVRAPEDVARIVAEAFHIAGTGRPGPVLIDIPKDIGLAACNYQPNAGI
SLRGYKPTFKGHPNQIVAAVDLIRQAERPLLYVGGGAVISGAHAEIQQLADRFQIPVTTT
LMGKGAFDENSSLSVGMLGMHGSAYANYAVQGCDLLIAVGARFDDRVTGKLDLFAPTAKV
IHIDIDPAELGKNRKPQVPIVGDVKHVIAAILGSTTYEEEVRTADWLRQIQAWKDDYPLV
VPQYPNCISPQEVIFEFGKQAPNAFFTTDVGQHQMWAAQFLKCGPRRWISSAGLGTMGYG
MPAALGAKVALPQEQVICISGDASFQMNLQELAVLSQYGINVKTAIINNGWQGMVRQWQE
SFYGERYSSSNMEVGMPDFVKLADAFGLKGMVIQHGDDIAAAVAEIIAHDGPVLADFHVK
RNENCYPMVAPGKSNSDMVGLTDPRQKHATPIVGLNGIVQRSHPAVAPTETV
Download sequence
Identical sequences K9SJB9
WP_015165198.1.5078 gi|428218198|ref|YP_007102663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]