SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428218216|ref|YP_007102681.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218216|ref|YP_007102681.1|
Domain Number 1 Region: 5-234
Classification Level Classification E-value
Superfamily PHP domain-like 3.92e-37
Family PHP domain 0.0072
Further Details:      
 
Weak hits

Sequence:  gi|428218216|ref|YP_007102681.1|
Domain Number - Region: 994-1084
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0465
Family Single strand DNA-binding domain, SSB 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428218216|ref|YP_007102681.1|
Sequence length 1191
Comment DNA polymerase III subunit alpha [Pseudanabaena sp. PCC 7367]
Sequence
MSSFVGLHVHTEYSLLDGASQISNLVDKVKELGMDAVALTDHGVMYGAIELIKTCEKKGI
KPIIGNEMYILNGDFTKQEKKRKYHQVVLAKNMQGYRNLVKLTSISHLDGYQGKGIFARP
CINKEYLFKYKEGLIVTSGCLAGEVPQAILQKHPDIARDVAALYKEQFGEDYYLEIQDHG
YPEDRIVNVEIVKIARELGIKVVATNDAHFVSCYDVEAHDALLCIQTGKLIRDVNRLRYS
GTEYVKSAEEMAQLYRDHLDDEVIAEAIANTLEVAAKVEAYDVMSEPKAANFDVPPGYTA
DTYLEKVTWDGLCDRRGVTSPEEVSNEDRERLLYELGIMQQKGFATYFLIVWDYIKYAKE
QQIPVGPGRGSAAGSLVAYALGITNIDPIHHGLLFERFLNPERKSMPDIDTDFCIEHRDQ
MIKYVTEKYGADKVAQIITFNRLTSKAVLKDVGRVLDISYGETDKMAKMIPVVRGKPTKL
GVMISDDTPASEFKERYEKEDHVFGWLDMAMRIEGVNKSSGVHAAGVVIAPMPLDQLVPL
QRNNDGAITTQYPMEDLESLGILKMDFLGLRNLTTIQRTVDLVREYKKPDFSIEEAVPDD
GSEEDKRTYALLAKGTLQGIFQLESSGMKQIVRDLKPSVIDDISSILALYRPGPLDAGLI
PKFINRKHGREPITYEHPSLEPILKSTYGVLCYQEQIMRMAQDLAGYSLGEADLLRRAMG
KKKVSEMEKQRGIFIAGAEDHGIPNQVAVSLFDQMVMFAEYCFNLSHSMAYGYVTYQTAY
LKANYPVEYMSALLSSASGDQAKVQKYIASCLSMGIEILPPNINRSGVDFTPSGQQILFG
LAAIKNLGSGAIEAILIARDEGGAFESLADLCSRVDTRVVNKKGLEALIQTGALDIINPN
RRQLISDLEPTLEWASKKAKEKASGQGNLFDMFGGGDDSNDVLSFADAPVGKPVAEYESQ
EKLSLEKELLGFYISDHPLKIVNSAARLMAPMNLADLEESREESTVTAIVLVLDIKNVVT
KKGDAMAILQLEDLTGSSEAVVFPRVYEKVKQYIEKDNRLLIWGKVDRRDEQTQLIINDM
QPIESVRLVKVSLSPDQVTSMQEWHQLREVLKSKSGEQPNNGGGNGNGYSKRRYQQSHNG
STKIPVIATVDSYPNFVVRMGNQFWVENDIDTVEALKAAGFDAASDHLITK
Download sequence
Identical sequences K9SJ71
WP_015165216.1.5078 gi|428218216|ref|YP_007102681.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]