SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428218330|ref|YP_007102795.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218330|ref|YP_007102795.1|
Domain Number 1 Region: 123-275
Classification Level Classification E-value
Superfamily Aspartate/glutamate racemase 3.92e-38
Family Aspartate/glutamate racemase 0.00034
Further Details:      
 
Domain Number 2 Region: 20-121
Classification Level Classification E-value
Superfamily Aspartate/glutamate racemase 1.96e-37
Family Aspartate/glutamate racemase 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428218330|ref|YP_007102795.1|
Sequence length 288
Comment glutamate racemase [Pseudanabaena sp. PCC 7367]
Sequence
MLFPGQSEPSLLHKCSSSYPIGIFDSGVGGLTVLRELRKQLPHESVVYFADTARLPYGSK
SPTEIIEFVYQILTWMRSQQVKMVIMACNTSSALALDILRPHFDFPVLGLILPGARAAVK
HGKHIGVIATEATVKSNAYAQAMQETQPNAKIWQIACPEFVPLIEGDRLADPYTIQVASN
YLEPLIQDQIDTLVFGCTHYPHLKGLLSQVLPYPVNFINPAAYVVKAAVKELEILGLRHT
NLELAVNNTFTRFYVSGDPQQFAKISSRWLNKMPSVEQVNLSHVELLS
Download sequence
Identical sequences K9SIE5
WP_015165327.1.5078 gi|428218330|ref|YP_007102795.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]