SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428218337|ref|YP_007102802.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218337|ref|YP_007102802.1|
Domain Number 1 Region: 185-641
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.76e-117
Family Amylase, catalytic domain 0.00000000407
Further Details:      
 
Domain Number 2 Region: 649-752
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.32e-32
Family alpha-Amylases, C-terminal beta-sheet domain 0.00037
Further Details:      
 
Domain Number 3 Region: 15-120
Classification Level Classification E-value
Superfamily E set domains 4.76e-17
Family E-set domains of sugar-utilizing enzymes 0.04
Further Details:      
 
Domain Number 4 Region: 145-200
Classification Level Classification E-value
Superfamily E set domains 0.0000000196
Family E-set domains of sugar-utilizing enzymes 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428218337|ref|YP_007102802.1|
Sequence length 765
Comment 1,4-alpha-glucan-branching protein [Pseudanabaena sp. PCC 7367]
Sequence
MIATISTEQIDKIVGNQHQDPFAVLGAHQVESDRTVGKVKWQVRAYLPNAEAVTVVLPQD
RDEYAMQSYHNPHFFVCEIETPELANYQLRVKEGDHERVIHDPYAFRSPSLTDFDIHLFG
EGNHHRIYEKLGSHPAQVNGVAGVNFAVWAPNGRNVSILGDFNSWDGRKHQMRMVGGGMW
ELFIPELKIGDRYKYEIKNTFGHIYEKSDPYGFQQEVRPGSCSIVNDLEYTWNDQDWLEQ
RRSSNPQEQPVSVYELHLGSWLHENADYIPKDADGNPEPVVTLGDKPGARFLTYRELADK
LIPYVKEAGFTHIELMPIAEHPFDGSWGYQVVGYYACTSRYGSPQDFMYFVDRCHQANIG
VIVDWVPGHFPKDAHGLAFFDGTHLYEHADPRRGEHKEWGTLVFNYSRNEVRNFLIANAL
FWFDKYHIDGIRVDAVASMLYLDYDRTEWIPNHYGGNENLEAVEFLRQLNHVIFGYYPGI
ISVAEESTSWAMVSRPTYLGGLGFNFKWNMGWMHDMLDYFSEDPIYRRYHQNNVTFSIMY
AFSENFMLALSHDEVVHGKRSLIGKMPGDEWQKFANLRCLLGYMYAHPGKKTMFMGMEFG
QYSEWNVNNDLDWHLLEHEPHRKMQHFVAILNKIYRREPALYSDDFSYNGFEWIDCNDAD
HSVVSFLRKDKHSNEFVVTVCNFTPNPLYDYWVGVPEAGFYQELINSDAEEFGGSNIGNY
GGKWSQAWYEHHKWDHCLSLTLPPLSVCMFKWVLPEDADINPVGK
Download sequence
Identical sequences K9SKQ4
gi|428218337|ref|YP_007102802.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]