SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428218343|ref|YP_007102808.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218343|ref|YP_007102808.1|
Domain Number 1 Region: 79-258
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.21e-50
Family Prokaryotic proteases 0.0001
Further Details:      
 
Weak hits

Sequence:  gi|428218343|ref|YP_007102808.1|
Domain Number - Region: 296-369
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0889
Family Collagen-binding domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428218343|ref|YP_007102808.1|
Sequence length 521
Comment peptidase S1 and S6 chymotrypsin/Hap [Pseudanabaena sp. PCC 7367]
Sequence
MSQGLKYKLFDLATSTGLCLGCGLLAMNISVGRSIASQFDLPPAPISDIPDIPISPSPIP
DQPLPPIYAQDINEQTNIRVYEIASPAVVSIQSGRGNGSGTIIDPKGLVLTSAHVVRTAQ
KVTVRLLDDRQFDGQVIASSRDPDLALIRLDRVTEPLPHVELISSANDIKVGQRAFAIGN
PFGRFAGTLTTGIVSRLDRDRHLIQTDAAINPGNSGGPLLNSRGQLIGVNSAIFTARGNE
GSIGLGFAIAADPVKDFVAAALSGQIGIDRSFKPPINLALNGRASRAALTASDETLPDGS
FYKAFTFNGTSGQKVNLQMRSNEIDSYMILLDGEGNKIAEDDDGGSGNDASITLTLPKDG
NYVVYANTYDVGEIGNFTISAQPLNINPNRSIPPSFPNSNTPRNSASAFSPAPNVILQRR
GILGPGSRVLARDGSLFEAFSFEGIAGQVVEITLASEDFRPYLVLFSPQKQVIEQNSGIT
ADRQNAAITLELPQTGTYGIVANTYDQSGRGEYVLTVKSLQ
Download sequence
Identical sequences K9SJT1
gi|428218343|ref|YP_007102808.1| WP_015165340.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]