SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428218397|ref|YP_007102862.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428218397|ref|YP_007102862.1|
Domain Number - Region: 15-111,144-169
Classification Level Classification E-value
Superfamily PP2C-like 0.00602
Family PP2C-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428218397|ref|YP_007102862.1|
Sequence length 358
Comment protein serine/threonine phosphatase [Pseudanabaena sp. PCC 7367]
Sequence
MSRTDRLSWHVVGESIQGAAHKKRHIPNRDNIFIWTPDNSGVGPPLVLTISDGRGSARCC
RSDLGSKFLVKIATRLLQNFAEKSPPLNNQAALIDSNQKLGRAIVLNWQKAIEKHLAQNK
LRPEEIARVGIAAGKSAQRAITTEPALAYGATLLGVLLTETYALYLKFGTGDLLSVDRNG
NPTSIFPAFGAELKTDQTDAYSHLTKSKIVDVLINPLWQELQIRLVPFVNYVPEMILVAT
DGYANSFKTELDFRKIAPDYLRLIEKEGIGSLINKLDLILTETSHQGGGDDITLGLLKSF
VEEDFDLEASAQTELAQNLAAFDQEMGITQPPPQHDRPKTALDPLSQQLNDLADEELN
Download sequence
Identical sequences K9SKV4
gi|428218397|ref|YP_007102862.1| WP_015165393.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]