SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428218676|ref|YP_007103141.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218676|ref|YP_007103141.1|
Domain Number 1 Region: 10-90,187-354
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.7e-44
Family Bacterial dinuclear zinc exopeptidases 0.0021
Further Details:      
 
Domain Number 2 Region: 80-195
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 0.000000000366
Family Aminopeptidase/glucanase lid domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428218676|ref|YP_007103141.1|
Sequence length 355
Comment peptidase M42 family protein [Pseudanabaena sp. PCC 7367]
Sequence
MEELLRPDRLYDLISELVMCHSPSGAEAEIDRYLLAQFANLELEHWQDAAGNIVAKIPGP
KNNPASNSAIAITAHKDEIGAIVKSINQYGQIEIGKLDGSFPWVYGEGIVDLLGDRETIS
AVLSFGSRHISHRSPQKELQTSKALSWDDAWLETKASPQKLAAAGIRPGTRMVISKHRKQ
PFRLSEDYVASYTLDNKASLAILLTLAEVIGQTNGQPKTDVYLLASANEEVGAIGAMYFS
NQRSLDALIALEIIPLSCEYPIEDNDAPVLLSQDAYGVYDENLNRGIAQIAQDHKLALQF
AVLNSFGSDGSIAMKFGHVPRAACLGFPTENTHGYEIAHLGAIANCIRLLYAYLK
Download sequence
Identical sequences K9SKG8
gi|428218676|ref|YP_007103141.1| WP_015165669.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]