SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428218684|ref|YP_007103149.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218684|ref|YP_007103149.1|
Domain Number 1 Region: 94-211
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 9.42e-23
Family Pentapeptide repeats 0.0014
Further Details:      
 
Domain Number 2 Region: 257-329
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.49e-18
Family Pentapeptide repeats 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428218684|ref|YP_007103149.1|
Sequence length 370
Comment pentapeptide repeat-containing protein [Pseudanabaena sp. PCC 7367]
Sequence
MKTTTLAVSILSMFFGFVGFGLTAGAENIEDVRQFIQTKKCPGCALSFFFSNGDHTQNYR
WYEPSLITYAYNFLEPASYVVKFRDSVDDTSDIDIDFSQANLSKADLYGATLLFNFTNAN
LSNADLRAAHLRGRFEGADFSGADLRNALLSGNLKGANFNNANLSRAKFILRSLVEVIDL
RGANLRNADLSYVSISHADLRGADLRGANVDFMKVSIPFVHPEKGFVAIGMLTIDENTLL
PPKLSILYEIAREGGVGKDLSNLDLSNSYLGMLDLRGADLSGSNLSNSILHSSDLGGANL
QNANLSGANLVDANFKDANLDSAILDGVVWCAPEIVTFVPASEELALALATGKAQPELIS
INECTKTNIK
Download sequence
Identical sequences K9SL81
WP_015165677.1.5078 gi|428218684|ref|YP_007103149.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]