SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428218705|ref|YP_007103170.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218705|ref|YP_007103170.1|
Domain Number 1 Region: 9-145
Classification Level Classification E-value
Superfamily RNase III domain-like 2.79e-44
Family RNase III catalytic domain-like 0.000096
Further Details:      
 
Domain Number 2 Region: 108-220
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.89e-21
Family Double-stranded RNA-binding domain (dsRBD) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428218705|ref|YP_007103170.1|
Sequence length 221
Comment RNAse III [Pseudanabaena sp. PCC 7367]
Sequence
MSTPSPLPQFKDPQLLEQALTHTSYAYENNLVAVNNQRLEFLGDAVVDFVVGEMLYHCYA
QMAEGELTRRRSMLVDETNLARLANQINLGEKLKLGKGTDLSGGRRSPSILSDAFEAVIG
AYYLDSGFAAVKIYLEGLFAPILETTRVVNSKSMFQQWVLGNISSNPPEYRIIAESGPAH
NKHFTAEVVVDGKSYGVGSGHKKQEAEKQAAEAALRQVGLL
Download sequence
Identical sequences K9SJE2
WP_015165698.1.5078 gi|428218705|ref|YP_007103170.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]