SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428218757|ref|YP_007103222.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218757|ref|YP_007103222.1|
Domain Number 1 Region: 5-187
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.84e-32
Family Pyruvate oxidase and decarboxylase Pyr module 0.0035
Further Details:      
 
Domain Number 2 Region: 564-590,622-746
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.95e-23
Family Pyruvate oxidase and decarboxylase PP module 0.0087
Further Details:      
 
Domain Number 3 Region: 246-391
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.00000888
Family Pyruvate oxidase and decarboxylase, middle domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428218757|ref|YP_007103222.1|
Sequence length 760
Comment 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [Pseudanabaena sp. PCC 7367]
Sequence
MNTANRNSFWASLVAAELDRAGVSAVCISPGSRSTPLAIACYQHPHLQTIVHIDERSGSF
FGLGLAKYTRATVALICTSGTAAANFYPAIIEAFYAQVPLIVLTADRPPELRDCGAGQTI
DQIKLYGDHVRYFFEVGLPDLSGFKLRHLRSLIGHATAIATGKTASAAGPVHLNFAFADP
LPPIEIADQVPANLAQTDRLAWQGRELTVNSWPRTNQLSTAGQSDNNPNYKTELSYIQVA
APQSQLSQVTLAQLGNLIATCAKGIIVVGVYDPPAGFAAAVKKLAQITGYPLLGEATGIM
RDRQVIGSYDVFLRSPQFCQTYAPELVIRFGAMPTAKSYRLWLEQHLNSQPIQQIIVGDG
SNNDPTHGLGIFVHADALSFCEQLSDYLAQNEQYLNLKSQYSSDYATPQEELPSPTRSPQ
SSRSAADNRSIDPGSISDQSRSNIAKQTQWQQAFWQAEKITIAAIAKCLAPIESLFEGKV
FDQLGKWLPIDCCIYVASSMPIRDLDSFFRQKEQLSPESQSISDPERADRLNQINQGDRP
SRVDPANTPISSDDKLASEPVAMTRVIANRGANGIDGTISSALGAAWGSSLLSGQSAGNG
QNLVQSKDRPIENNYSSNHRNPQPVILICGDLAFYHDLNGLMAVKQYQLNLTIILLNNNG
GGIFDMLPIAQFPEVCEPLFNTPHDLDFAPIVAVYGCEHVAIESWAQFKTEVLASLTKPG
TQVLELKSNRQQNHQTRQQIWQEVKEAIADHFSFNNNFGR
Download sequence
Identical sequences K9SLZ6
WP_015165750.1.5078 gi|428218757|ref|YP_007103222.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]