SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428218774|ref|YP_007103239.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218774|ref|YP_007103239.1|
Domain Number 1 Region: 23-245
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 4.77e-58
Family Class I glutamine amidotransferases (GAT) 0.00000927
Further Details:      
 
Domain Number 2 Region: 202-460
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.53e-52
Family N-type ATP pyrophosphatases 0.00000336
Further Details:      
 
Domain Number 3 Region: 419-540
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 6.67e-49
Family GMP synthetase C-terminal dimerisation domain 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428218774|ref|YP_007103239.1|
Sequence length 540
Comment GMP synthase [Pseudanabaena sp. PCC 7367]
Sequence
MVSTSQPIPSTDPSTQSEKVSDRPMIAIVDFGSQYSELIARRIRETQVYSEVMPYYTSAE
EIAKFRPRGIILSGGPNSVYAPNAPHCDPGIWDLGIPILGVCYGMQLMVQQLGGRVEQAD
RGEYGKASLTIDDPTDLLTNVDDGAVMWMSHGDSVLEMPAGFTVLAHTANTPCAAIANPE
RNFYGVQFHPEVVHSIGGKALIRNFVYHICECEPTWTTESFIEESIREIRSQVGEKRVLL
ALSGGVDSSTLAFLLHRAIGDRLTCMFIDQGFMRKGEPERLVKLFKEQFHIPVEYINASD
RFLNLMEGIIEPERKRKLIGYEFIKVFEEESRRLGPFDYLAQGTLYPDVIESADTNIDPA
TGKRIAVKIKSHHNVGGLPPDLRFVLVEPLRKLFKDEVRKVGTVLGLPAEIVKRQPFPGP
GLAIRIIGEITPERLEMLRDADLILRQEINRSGMYNELWQAFAVLLPTVRSVGVMGDART
YAHPVVLRFVTSEDGMTADWAKVPYELIGTIANRIVNEVPGINRVVMDVTSKPPGTIEWE
Download sequence
Identical sequences K9SLJ4
WP_015165767.1.5078 gi|428218774|ref|YP_007103239.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]