SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428218930|ref|YP_007103395.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218930|ref|YP_007103395.1|
Domain Number 1 Region: 312-611
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.09e-85
Family DNA repair protein MutS, domain III 0.000000885
Further Details:      
 
Domain Number 2 Region: 613-845
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.49e-59
Family ABC transporter ATPase domain-like 0.000000758
Further Details:      
 
Domain Number 3 Region: 10-125
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 5.49e-38
Family DNA repair protein MutS, domain I 0.0000592
Further Details:      
 
Domain Number 4 Region: 127-204,242-324
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 7.59e-38
Family DNA repair protein MutS, domain II 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428218930|ref|YP_007103395.1|
Sequence length 905
Comment DNA mismatch repair protein MutS [Pseudanabaena sp. PCC 7367]
Sequence
MTNLALNSSQIDRNALTPMLQHYMGVKDRYSHAVLLYRMGDFFETFFEDAQLVSRELELV
LTGRDGGKTLGRIPMAGIPHHALDRYARQLVAKGFSIAICDQVETAAQAQGLVKREVTRV
LTPGTVIEAGMLAAKQNNFLAAIVAADPSHQKSNGNSKGNKKWGLAFADISTGEFMTTQL
ANTEQLVQELLRLQPAEVLFPTDAPNPNLFDSYSNYDDKKRSPQLDAIPPELPDFLCYTL
RSQTSFLLVEAKQKIMTTYKVRSLEGFGCASLSLAIRAAGGLLEYLDSTQKDLKAPLHNL
TTYTVTDYLILDHQTRRNLEITQTVRDGTLAGSLLWALDCTSTSMGSRALRRWLLQPLKD
TQQISDRADTVAELFQHHNLRKNLRALLHEIYDIERLCSRIGAGTANARDLVALADSLSK
LTDVADLLAKAESPYLKTLQSPPLELAELANFLSDTLIDSPPIYLTEGNIIRDGVSPQID
QIRQQSAADVEWLATLEKTERERTGINTLKVGYNKAFGYYLSISRGKSDQAPDDYIRKQT
LTNEERFITPELKEREARILNAKAEINQLEYDLFVQLRSQAATHITAMRSVARDLAAADA
LASLAEVANKYDYCRPEITSDRTINIQNGRHPVVEQSLPSGFFVPNSARLGCTQAPDLII
LTGPNMSGKSIYLRQVGLIQLMAQVGSFVPAQSATLGISDRIFTRVGAVDDLATGQSTFM
VEMNETANILNHAQDHSLVLLDEIGRGTSTFDGMAIAWSVAEHIAKQIQARAIFATHYHE
LNELASLLTNVTNFQVTVKELEDEIIFLHQVQPGGADRSYGIEVGRLAGLPPAVIARAKQ
VLEQIARNSHIATGLRRGSSAKATKGKKNQAKSQLSIFETSMEGSASHNQANPDLDLDSA
TDPDN
Download sequence
Identical sequences K9SK31
WP_015165923.1.5078 gi|428218930|ref|YP_007103395.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]