SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428218976|ref|YP_007103441.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218976|ref|YP_007103441.1|
Domain Number 1 Region: 2-108,140-178
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.13e-29
Family N-terminal domain of MutM-like DNA repair proteins 0.00055
Further Details:      
 
Domain Number 2 Region: 185-268
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.13e-25
Family Middle domain of MutM-like DNA repair proteins 0.0029
Further Details:      
 
Domain Number 3 Region: 268-318
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000112
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428218976|ref|YP_007103441.1|
Sequence length 321
Comment DNA-(apurinic or apyrimidinic site) lyase, Formamidopyrimidine-DNA glycosylase [Pseudanabaena sp. PCC 7367]
Sequence
MPELPEVETVRVGLSKNTIGRSIAATEVILERMVAAPNNPAEFAKALQGAIFQGWQRRGK
YLLAKLSDHKGSDRGWLGVHLRMTGQMLMVDRHEPIHSHTRIRLFLDRLNGQAKSPRLRD
SGAGSDPRSPQINKSLDSLEQELRFADQRTFGRMWWVPPGVEPEQVITGLQLLGVEPLLA
DYSRNPKLSAAYLTKRLSKSNRAIKTALLDQAIVAGIGNIYADETLFLSKIHPEQKALSL
TKAQIKRLPDAIAKSLQAGIAHGGTTFSNFQDVAGDKGNYIYSAWVFRRQGQPCRVCNTT
IERIKVGGRSTHFCPKCQSSP
Download sequence
Identical sequences K9SLB3
WP_015165969.1.5078 gi|428218976|ref|YP_007103441.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]