SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428218986|ref|YP_007103451.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428218986|ref|YP_007103451.1|
Domain Number 1 Region: 1-212
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.92e-49
Family Phosphoglucomutase, first 3 domains 0.0000016
Further Details:      
 
Domain Number 2 Region: 410-544
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 9.94e-49
Family Phosphoglucomutase, C-terminal domain 0.00002
Further Details:      
 
Domain Number 3 Region: 279-415
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.43e-37
Family Phosphoglucomutase, first 3 domains 0.0000146
Further Details:      
 
Domain Number 4 Region: 183-293
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 9.42e-29
Family Phosphoglucomutase, first 3 domains 0.0000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428218986|ref|YP_007103451.1|
Sequence length 544
Comment phosphoglucomutase [Pseudanabaena sp. PCC 7367]
Sequence
MDIKTISTTPFDDQKPGTSGLRKKVPVFQQPNYLENFIQATFNSIPERVGQTLVLGGDGR
YYNREAIQIILKMAAANGFARTLVGQGGILSTPAASCVIRKYKAIGGIILSASHNPGGPK
EDFGVKFNTSNGGPAPEKVTSAIFAESQRISEYQILEAEDIDLDKQTKTQLGNMTVEVID
AVTDYAGLMESIFDFGRINQLLTSGTFRLSFDALHAVTGPYAKAIIEQRLGAKPGSVVNA
IPLEDFGGGHPDPNLVYAHDLVETMFGDNPPDFGAASDGDGDRNMVLGSKFFVTPSDSVA
IMAANAKLVPGYANGIAGIARSMPTSQAADRVAAAMGLDCYETPTGWKFFGNLLDAGKVT
ICGEESFGTGSDHVREKDGLWAVLFWLNILAVRQESVEQIVTEHWRTYGRNFYSRHDYEG
IASDKANQLMQQLRDRLGSLPGSKLGNHQVKYSDDFSYTDPVDGSISKKQGIRIGFEDGS
RIVFRLSGTGTQGATLRVYLESFEADPAKHDQDTQAALADLIAIADQVAQIQAITERDQP
TVIT
Download sequence
Identical sequences K9SLC1
WP_015165979.1.5078 gi|428218986|ref|YP_007103451.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]