SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428219058|ref|YP_007103523.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219058|ref|YP_007103523.1|
Domain Number 1 Region: 208-401
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.22e-65
Family B3/B4 domain of PheRS, PheT 0.00000432
Further Details:      
 
Domain Number 2 Region: 497-707
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.72e-43
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000705
Further Details:      
 
Domain Number 3 Region: 36-196
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.83e-40
Family Myf domain 0.0017
Further Details:      
 
Domain Number 4 Region: 718-816
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 8.76e-31
Family Anticodon-binding domain of PheRS 0.00062
Further Details:      
 
Domain Number 5 Region: 411-504
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000119
Family Domains B1 and B5 of PheRS-beta, PheT 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428219058|ref|YP_007103523.1|
Sequence length 817
Comment phenylalanyl-tRNA synthetase subunit beta [Pseudanabaena sp. PCC 7367]
Sequence
MYISINWLKELIEFDLTAEDLAHKLTMSGFEVEGIEDRRTWADGVVLGQIITADRHPNAD
KLQVCSVDVGAAEKLEIVCGAANARAGIYVAVATIGTYLPRIDLKIKSAKLRGVKSSGMI
CSLAELGLTKDSEGIYEFSFADENIPALGSDVRPWLGLDDVILDVTSTANRADALSMVGI
AREVAAFSGGKLSLPEPNLTGEPKQGDWVSVEEPKGCPAYSGSLIKGIKIAESPTWLKQR
LVAAGMRPISNIVDITNFVMLEWGQPLHAFDANKLAENLQIGVRFARASEKEQLKTLDDQ
KRDLQNQSFIITSGDRPVALAGLIGGADTEVGDQTVDIMLEAALFDSATIRRSARAHGLR
TEASARFERGVNFSGLETARDRAIQLILEIAGGELTEQSVVDNRAPLTRTIELRLSRVQE
ILGSIEADDGELADLPAMAVEQTLATLGFELQSHSTNNNGDRHLDQGSAAIKWLVKVPSY
RYADIEREIDLIEEVARIYGYDKFVETLPDRTELGFLSLDYLLTRQLREILKGVGLTELV
HVSLTSPTEDNQVLVANPAAAEFSALRKDLLAGLIDAFASNISNGNGSLWGYEIGSVFWL
DEEGSNEATHLGGILGGDPTVGVWQKSSQPINWYEAKGMLETVFHRLGVEVEYQPDRADA
RLHPGRTASLWIDGNRLGVFGQLHPELIQQRELPDQVYVFELDLFTLLEAVAQLAIPIFK
TYSTYPSSDRDIAFFAANSISVAELQRSIKRSGGALLESVDLFDQYIGKGVPEGQRSLAF
RLVYRASDRTLTDEDVNKVHQQVRDNLEEKFSVSLRS
Download sequence
Identical sequences K9SLT8
WP_015166051.1.5078 gi|428219058|ref|YP_007103523.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]