SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428219069|ref|YP_007103534.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219069|ref|YP_007103534.1|
Domain Number 1 Region: 316-495
Classification Level Classification E-value
Superfamily alpha/beta knot 2.62e-45
Family SpoU-like RNA 2'-O ribose methyltransferase 0.0000206
Further Details:      
 
Domain Number 2 Region: 248-325
Classification Level Classification E-value
Superfamily L30e-like 3.18e-16
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428219069|ref|YP_007103534.1|
Sequence length 502
Comment TrmH family RNA methyltransferase [Pseudanabaena sp. PCC 7367]
Sequence
MTKFKRDSGNFRKGRKDSSDKNPRWSKSTENRSTRSAKPKSFKRKRYGEDSAAQSGSNAA
NDKPKPRPKLGTLKLRGSSRTTDSGRVGRKFGRSNDRKGRDAKQTNKTGGYDRKSADRRY
EHKPGRVERVERSDQYDKYDRGDSIPKPKLDLDRDRNPARSNGHKDNHKSDSDYGSDYQP
ASRSDKPSKSPKSHESDYSPRSANFKSEPRADRKFNRFDSRTEKDRAVHQPEPDPNTLIN
RDRGDDQDSPDLVYGRHAVAAAMESGRSLHRLWVTNRLRYAPDFLPLINAAKESGCVIDE
VDIVRLNQITHNARHQGIAAQVAAYAYLELGELINQAKQASQNPVIIVADGITDPHNLGA
IARSAEAIGAHGLVIPQRRAVGITSTVTKVAAGALENLAVARVTNLTRALEQLKSEEFWI
YGTAAESGQPIHKVDLLGAVALVIGSEAEGLSMLVQRSCDVLVSIPLGGKTPSLNASVAA
GMALYEVFRQRWQNTLSLNNLS
Download sequence
Identical sequences K9SMA0
gi|428219069|ref|YP_007103534.1| WP_015166062.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]