SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428219098|ref|YP_007103563.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219098|ref|YP_007103563.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 7.98e-45
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00045
Further Details:      
 
Domain Number 2 Region: 160-320
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1e-32
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00046
Further Details:      
 
Domain Number 3 Region: 323-426
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 2.75e-26
Family Glutamyl tRNA-reductase dimerization domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428219098|ref|YP_007103563.1|
Sequence length 434
Comment glutamyl-tRNA reductase [Pseudanabaena sp. PCC 7367]
Sequence
MNIAVIGLSHKTATVEVREKLSIPEARVESALNQLTSYPNIDEAAVLSTCNRLELYVVMR
ETEGGIRETAQFLSEFSELPLHMLRRYLFILLRQDAVMHLMRVAAGLDSLVLGEGQILAQ
VKQTHRLAQQHKGAGRILNQLFKHSVSSGKRVRTETDIGTGAVSISSAAVELAQMKLQDL
SDKHVAIAGAGKMSRLLVKHLLSKGAKKITIVNRSAKRAEDLIAQFSCEAEGAEFQIQPI
DNLCDCVAVSDLVFTSTGATNVLLSKSNLAPVVSDHSGLMIVDISVPRNVHADVKELANV
NCYNVDDLEAVVAENQESRRQMAMQAEILLEGCAEEFETWWRSLETVPTISKLRQKMEVI
REQELEKALSRLGNEFAEKHQDIIENLTRGIINKILHDPMVQLRAQQDIEARRRTMHTLH
ELFNLETHLKDQST
Download sequence
Identical sequences K9SLX3
gi|428219098|ref|YP_007103563.1| WP_015166091.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]