SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428219275|ref|YP_007103740.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219275|ref|YP_007103740.1|
Domain Number 1 Region: 322-453
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-33
Family cAMP-binding domain 0.0018
Further Details:      
 
Domain Number 2 Region: 188-284
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 3.4e-26
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0021
Further Details:      
 
Domain Number 3 Region: 117-182
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 2.62e-17
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0012
Further Details:      
 
Domain Number 4 Region: 31-115
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000000000484
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428219275|ref|YP_007103740.1|
Sequence length 493
Comment mechanosensitive ion channel protein MscS [Pseudanabaena sp. PCC 7367]
Sequence
MFQGIQNFVEEFLDILKTPLFTLGNTDISITSFLLLCFYLVIIFILARTLRQFLRNRVLS
RAGFDSSNREIVSAILSYGIGAIAAVMVLQTIGINIASLAVLAGGLGIGIGFGFQDVTKN
FVSGVTILLERKLKVGDFVEFDGLEGYVREISIRSTIIRTLDRGDVVVPNSQLVENRVLN
WSYDSFTARIRVPVGVDYSSDPVAVTEALLDSAYMEPAVLLNPAPKVFFRGFGDSALNFE
LRVWINRIDDRDPIISSLNFIIEYNLRQQGISIPFPQRDLWIKNPESLRNGASHKTELPA
LTPLNSEGQPVEPASRPLPLRDLLRRVAYFEHFSELELRELIEIGYRRRLHSGDVLFREG
DPGDSFYIILSGLVEVFVQKLDKSLCELGVGEFFGELSLMLSIPRTASIRAIDETMVFVI
SHRGFEKLLHAHADLAENIVQELGKRKDELAERQDQLRAMGLVGADEDDKNPVEWVRKRL
KRLFKLDLDTSTW
Download sequence
Identical sequences K9SL52
gi|428219275|ref|YP_007103740.1| WP_015166268.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]