SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428219369|ref|YP_007103834.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219369|ref|YP_007103834.1|
Domain Number 1 Region: 23-239
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.39e-56
Family PP-loop ATPase 0.00033
Further Details:      
 
Domain Number 2 Region: 218-319
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 2.62e-20
Family MesJ substrate recognition domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428219369|ref|YP_007103834.1|
Sequence length 337
Comment tRNA(Ile)-lysidine synthase [Pseudanabaena sp. PCC 7367]
Sequence
MSGKIAKLLPAKLSEILRSPPPLLPNGAKILIAVSGGQDSLCLAQLLIKLQASWDWQLAI
GHCDHRWRSDSQANARHVANLAKNWGLPFWLRTATTPPASEATAREWRYGQLIELAQQTN
YNYVVTGHTRSDLAETFLYNAIRGSGSDGLRSLGWQRELSQGILLVRPLLSFSRSQTGSF
CEAMSLPIWEDATNQDLKHSRNRIRLELLPYLEQHFNPQVERSLAQTAAILRDEVELLET
LATQAWQPEALPRIDRLKLRDLPKALQRRVIRQFLQKHLSKAPNFEQIEKVVSLIYAPRR
SRTDPLPGDVWAEVEHSWIWLRSEPNSGSEPNKSNHH
Download sequence
Identical sequences K9SN65
gi|428219369|ref|YP_007103834.1| WP_015166362.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]