SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428219393|ref|YP_007103858.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428219393|ref|YP_007103858.1|
Domain Number - Region: 30-108
Classification Level Classification E-value
Superfamily Clc chloride channel 0.00863
Family Clc chloride channel 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428219393|ref|YP_007103858.1|
Sequence length 261
Comment hypothetical protein Pse7367_3182 [Pseudanabaena sp. PCC 7367]
Sequence
MPARRPANPAPKLSPLKLIAPWLDTLAIAAWGLLFFKLWFTQELFLLIHPNYMWLTIVAG
VILLIFAGFEGVRVAKRRRYFSTASHTTILLPSLGSSLLLVVAILGLLISPRAFASDMAL
QRGVNETLRDTRSNPESFRANRKPEDRTLIEWVRTLNVYPEPDAYNGQAADVIGFVVHPE
SMPANYFVVTRFVITCCAADAYPVGLPVRVESTVDRANFKPDQWVQVEGQMITEELEGQR
QLVIASNKITPVDRPKKPYDY
Download sequence
Identical sequences K9SMS1
WP_015166386.1.5078 gi|428219393|ref|YP_007103858.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]