SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428219442|ref|YP_007103907.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219442|ref|YP_007103907.1|
Domain Number 1 Region: 1-280
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.38e-73
Family Cytidylytransferase 0.0094
Further Details:      
 
Domain Number 2 Region: 244-432
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 5.59e-31
Family gamma-carbonic anhydrase-like 0.017
Further Details:      
 
Domain Number 3 Region: 637-743
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.00000000000000942
Family Phosphoglucomutase, first 3 domains 0.0072
Further Details:      
 
Domain Number 4 Region: 746-813
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.00000000262
Family Phosphoglucomutase, C-terminal domain 0.013
Further Details:      
 
Domain Number 5 Region: 532-633
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 0.00000000381
Family Phosphoglucomutase, first 3 domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428219442|ref|YP_007103907.1|
Sequence length 853
Comment Mannose-1-phosphate guanylyltransferase, Phosphoglucosamine mutase [Pseudanabaena sp. PCC 7367]
Sequence
MRAVLMAGGSGTRLRPLTCDLPKPMVSILNRPITEHILNLLTRHHIHEVIATLHYLPDSI
RDYFGDGSDFNVTMRYVVEEDAPLGTAGCVKNVEHLLDSTFIVISGDSITDIDLSKAIAF
HQRKGSKATLVLKRVNDPMAFGVVITDDQYRIRRFLEKPSSSEVFSDTVNTGIYILEPEV
LQYLSADEPSDFSQDLFPLLLENKVPMYGYIADGYWCDVGSLDAYRQAQYDAIRNRVSLE
LEYLQLRTGIWVGQNTMIDPTAFIEAPVLIGDNCSIGPRVHISAGTIIGDHVTIRADADL
QHPIICNSVVVGEESHLWACTVARNSRISRRSHLMEGAVVGANAVVGEEARICANVRIWP
EKKVEDGATLNHNLIWGSMAVRNLFGHRGVSGLANIDITPEFAVKLGAAYGATLKPGAQV
MVSRDQRTVCRMVTRSLISGLMSVGITIRNLEATAIPIARYIAPSLTVEGGIHVRLHPDK
SDHILIEFLDNNGINIDKKKEKKIEGTYFKEDFRRARIEEIGQINYPSRIFEYYSSGFAR
NLNTEALRGSGHKKIVIDYAYAVSGAVLPRILGKYGSDVVVMNASLHDRAPTRGDREKML
DQLSDVVTALKANFGVQVFANGEKLVIIDERGKAIRGEILTGIMAEMAFTANPRGTIVIP
MSVSGIVEQLAKKHQGRVLRTKDNPTAVMMACASNSEVILGGSSEMGFIFPQLHTGFDAM
FSIAKIIEWLTIQERSTSHLRQSLPQVNYCAQKIRCSWGIKGSLMRHLVESHQHHRLELI
DGIKICYDDDDWVLVLPDAGEPMVHVYASSANKGEVGLPWVELQVKEMCDYIETFCRLQS
SLNKEAAGSGLGL
Download sequence
Identical sequences K9SNU8
gi|428219442|ref|YP_007103907.1| WP_015166433.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]