SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428219581|ref|YP_007104046.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219581|ref|YP_007104046.1|
Domain Number 1 Region: 186-338
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 9.53e-44
Family Pentapeptide repeats 0.0000992
Further Details:      
 
Domain Number 2 Region: 17-173
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.45e-39
Family Pentapeptide repeats 0.00015
Further Details:      
 
Domain Number 3 Region: 328-465
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.62e-33
Family Pentapeptide repeats 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428219581|ref|YP_007104046.1|
Sequence length 508
Comment pentapeptide repeat-containing protein [Pseudanabaena sp. PCC 7367]
Sequence
MANDQHLKLIGKGVTAWNQWFEKNGSIQADLSEACLIGVTLTRIELLNAELSRIDLSRAD
LSESNLKRANLTEAVLVGADLISINLGRATLTEANLNRANLIGANLSGAILVEADLARCD
LRVSNLTKADLMGANLSGADLSVANLSGANLSQVDLSKATLVEANLKDAKLSVASFNGAN
LTGASLAKLDLSGLDLSDANFSGADLRGANLSGANLNGADLSRANLSRANLSRANLSRTN
FVRTELNEANLSEASLSGSNLSRADLSRANLIKADLHGANLSMSKLAGAYLVRANLLGTN
LISADLTRAVLIEADLFRANLTEANLSRADLNRANLTEASFIEANLISANLCGTDLTRAN
LTGVYAIDAEIVGAILIKTNLSEASLAGANFVRANLSRAILSGASLSEANLGRANLYGAN
MSEANLSGANLENADLSRAQAIATNFTSTKLNGVCVQDWQINSATQFDDINCEYIYLKSN
GKERYPAAGQMIEGELKQLLQNKLCNRA
Download sequence
Identical sequences K9SN28
WP_015166572.1.5078 gi|428219581|ref|YP_007104046.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]