SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428219582|ref|YP_007104047.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219582|ref|YP_007104047.1|
Domain Number 1 Region: 321-371
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.000000016
Family GSPII protein E N-terminal domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 373-427
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.0000000288
Family GSPII protein E N-terminal domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428219582|ref|YP_007104047.1|
Sequence length 438
Comment WecB/TagA/CpsF family glycosyl transferase [Pseudanabaena sp. PCC 7367]
Sequence
MTITPINTKDAGFIDRPVSSIATVAPLIVNPDRPEAIPTKRILRNPVTAMEFEQQVTTIM
QWAESRQSKAVCVANVHMLMEAYWRPEFAAVLRKAELVTPDGMPLVWMLRQLGMKTQDRV
AGMDIFHALCERSRQQNLNIFFVGSTPQILDSMGAKLAQQYPGLNVVGMESLPFRPLTEQ
EDQELIAKIESSQANLVMVALGCPKQEYWIAQHKDKINAVMIGLGAVFAVYAGVHKHAPK
WVQKSGLEWSYRLMQEPRRLFGRYSSTIPPFVWLAVKQLLTESIGDRRRDAYFESSTVKH
SAPVMPAIEALGEQIEQAAMIGEILVKHRIITKTHLAQALQQQQQTGQKLGEILIQNQLV
SALELEKSLKNQSIKLGQLLVRNQIISQELLEQTLQKQKRSHAKLGECLLQQGVVAPEQL
ENILLEQCWRRKGVWMVA
Download sequence
Identical sequences K9SP83
WP_015166573.1.5078 gi|428219582|ref|YP_007104047.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]