SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428219843|ref|YP_007104308.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219843|ref|YP_007104308.1|
Domain Number 1 Region: 128-401
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.07e-106
Family BC ATP-binding domain-like 0.0000000104
Further Details:      
 
Domain Number 2 Region: 680-948
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 9.72e-100
Family BC ATP-binding domain-like 0.000000273
Further Details:      
 
Domain Number 3 Region: 396-552
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 2.88e-51
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0001
Further Details:      
 
Domain Number 4 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 6.33e-49
Family BC N-terminal domain-like 0.00000234
Further Details:      
 
Domain Number 5 Region: 556-682
Classification Level Classification E-value
Superfamily PreATP-grasp domain 7.77e-46
Family BC N-terminal domain-like 0.00000283
Further Details:      
 
Domain Number 6 Region: 950-1084
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 1.44e-36
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428219843|ref|YP_007104308.1|
Sequence length 1085
Comment carbamoyl-phosphate synthase large subunit [Pseudanabaena sp. PCC 7367]
Sequence
MPRRNDIQKILLIGAGPIVIGQACEFDYSGTQACKVLRDEGYYVILVNSNPATIMTDPAM
ADRTYIEPITPEIVAQIIEKERPDAILPTMGGQTALNTAVALAENGTLDKFGVELIGAKL
EAIQMAEDRKLFKEAMERIGVAVCPSGLANTMAEAREIAAQIGTYPLIIRPAFTLGGTGG
GIAYNQEEFEEIAASGLDASPTSQILVEQSLIGWKEYELEVMRDLADNVVIICSIENIDP
MGIHTGDSITVAPAQTLTDKEYQRLRDYSIKIIREIGVETGGSNIQFSVDPETGDVIVIE
MNPRVSRSSALASKATGFPIAKFAAKLAVGYTLDEIPNDITKKTPASFEPTIDYVVTKIP
RFAFEKFPGSEPVLTTQMKSVGEAMSIGRTFQESFQKALRSLETNRYGFGADRLEEMPSL
EQVKASLRVPNPERIFSIRHGFLLGLSVPAIAQLTGVDPWFLQKMGELVDMELAIKGNSL
SEIDADQMLSIKQMGFSDRQIAFLTSTDEDDVRIHRKSLGIVPAYKTVDTCAAEFEAFTP
YHYSTYETETEVQPSDRRKVMILGGGPNRIGQGIEFDYCCCHASFSLRDKDFETIMVNSN
PETVSTDYDTSDRLYFEPLTREDVLNIIETEKPEGIIIQFGGQTPLKLSVKLLSYLEEHQ
AELGTKIWGTSPDSIDASEDRERFEAICKDLGIVQPRNGLARSEEEALKVASNIGYPVVV
RPSYVLGGRGMEVVYSDEDLKDYMYKAILIEPEHPVLIDQFLEGAIEVDVDAIADQTGKV
VIGGIMEHIEEAGIHSGDSACAIPTFSLAETTLNTIREWTIKLAEKLKVVGLMNVQYAVQ
ISPNDPKLAQVYILEANPRASRTVPFVSKAIGVPLVAYASRIMAGETLEQLGLTKEIVPK
HIAIKEAVLPFAKFSGTDTILGPEMRSTGEVMGIDTEFGRAFAKAQLAAGQKLPLEGAVF
ISVNDRDKAGVAAVAEGFVDLGFQVIATEGTHRILKKKNIKAELVLKVSEGRPNISDVIK
NKQVQIIVNSPSGEEAQADGKLIRRAALVYKIPVITTLAGAKAVIAAIRSLQNESLVVKP
IQEYV
Download sequence
Identical sequences K9SP09
gi|428219843|ref|YP_007104308.1| WP_015166832.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]