SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428217337|ref|YP_007101802.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428217337|ref|YP_007101802.1|
Domain Number 1 Region: 1-162,190-286
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.03e-27
Family ABC transporter ATPase domain-like 0.0062
Further Details:      
 
Domain Number 2 Region: 1-51,573-785
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.78e-25
Family ABC transporter ATPase domain-like 0.0075
Further Details:      
 
Domain Number 3 Region: 360-457
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0000000929
Family Rad50 coiled-coil Zn hook 0.0053
Further Details:      
 
Weak hits

Sequence:  gi|428217337|ref|YP_007101802.1|
Domain Number - Region: 547-585
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0127
Family Rad50 coiled-coil Zn hook 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428217337|ref|YP_007101802.1|
Sequence length 809
Comment SMC domain-containing protein [Pseudanabaena sp. PCC 7367]
Sequence
MRLIGLELTNFRQHKSTEIQFPSGLTGILGENGSGKSTILEAIAWVLYGNQKGVARGDVD
SLIWRQAPGKSAASVMLKFAFGDRHYQIKRSQSSSRGTVDLQQDGRTIANSNKAVAEKLT
EIIGMSHTEFFNSYFTGQKDLSFLGSIKGATERERFIAKMLGYEKITAAQGEAGKAGSIR
SDRRNQQRQVDRLEGSRGDLDKIKAQITFQQTELEAAQSSSEAVTVVLMSALEQKQALEP
QLTELEQKRDRHVELDKQQQIKTAALTKLTQQIDRLGQEQVRRREAVGKYDRLSQALQNY
DQIKAQHNHLSELKQAATRRNDLSVRLPKLRAEITELKQNLDRLDQVESRLAKTKQAIAH
FQQELETTEAEIRTQTRSWQEQQANLRAQITSEQKNLRNITKQKNVIVQAGHDGICPTCE
RPLQAEYDTVVGNFASQVVHLESHIKEWQQQLSAIDAPPPSLQQSQQQQLQLKQDYQNEQ
RLEQQLTADLAKRQLWQKAQDEKQAEVTNVTAQIAAIPSGFDAQTHTQLEQQLQQLEPQR
EEFLRLANAPQQLQDINAQLSELTQEKAQVETAIAELNDQIQLLKFDPAAYAQVKQAIAT
ASQELEAARIAQIEAKAKVENTQKMLELAQQQEVEFHRRDAEYQKAKQELILLDELDSAF
TELRQYLTEQIRPQLAESASIFLTQLTDGRYDAIEIDPKYNILVLDHGDPKPVISGGEED
IVNLCLRLAISQMITERSGQPFSLLILDEVFGSLDQGRRENVIGLLHSLEQQFEQVLIIS
HIEAIKEGVNQAIRLEFDPQEQCSKLVSA
Download sequence
Identical sequences K9SHW8
gi|428217337|ref|YP_007101802.1| WP_015164347.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]