SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428219583|ref|YP_007104048.1| from Pseudanabaena sp. PCC 7367

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428219583|ref|YP_007104048.1|
Domain Number 1 Region: 390-484
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000141
Family Anti-sigma factor antagonist SpoIIaa 0.0025
Further Details:      
 
Weak hits

Sequence:  gi|428219583|ref|YP_007104048.1|
Domain Number - Region: 251-308
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.000502
Family UDP-N-acetylglucosamine 2-epimerase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428219583|ref|YP_007104048.1|
Sequence length 743
Comment anti-sigma-factor antagonist and sugar transfersase [Pseudanabaena sp. PCC 7367]
Sequence
MILVTLGSSQYPCKSLLSWLELLIRYELIDEKILVNTPGNILPNPTIKSQHLQAISLTTQ
KLQEKIAQARVVIGDCSEYCIDLLENSGRPFALVPLNPSCGEVDDDRQFEIAETLEQQGF
TIARSPLELVKFLAAADFAKFLDLLGKPEPDQVDPKVVKFLLASGFSKFLYARGMSRLSD
LADLKNTEPPEPPSRLANLVNYLGDRVVAKKVMLVCSAGNSFKTMQSLNAVWQDCAKTSW
VTPATSIAKVVTRHQDTYWGHTPNRRQPINWCRNTWLAIKALHQQKPDLVFSTGGGLAIP
FLLVAKFIYGCQTVFLEASTRAKVLSFPARLLNRLNALDRLFVQDHALAMRYLEQPSPNI
DYAANGAEVAEPAQSDSKNSSSQTSPLTVFCFRDTVFISTPTHLTSAEAAQFRNHIGEIC
QTSFSKIVVDMSQTESIDGSGVGALIGVLKIANATGSEMVLWSVNKAVMSALAIAKLVRL
FTIRAATQIFRIEPITQIVHHCPIALQEHPQPTLHPSVLSPTKRAIDVAGALVGLAITAM
IFIPVSIAIWLDDPGPILFSQVRCGLMGRPFRIWKFRTMVTNAEALKSQVKNQYANDAFF
KSDHDPRITRIGRFLRKTSLDELPQFWNVLSGDMSLVGTRPPTKDEVEKYKLELLKCDLP
APVGKVNLATMTFPATIATEWSRLDVTPGLTGEWQVNGRSSVRKFEDVVKLDLNYQQKWS
LHYDLWLILKTIFVLFNKKNQAV
Download sequence
Identical sequences K9SN94
WP_015166574.1.5078 gi|428219583|ref|YP_007104048.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]