SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ConsensusfromContig10545-maker-ConsensusfromContig10545-snap-gene-0.1-mRNA-1:cds:3507/6777-6828:0:- from Cyanophora paradoxa

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ConsensusfromContig10545-maker-ConsensusfromContig10545-snap-gene-0.1-mRNA-1:cds:3507/6777-6828:0:-
Domain Number - Region: 47-98
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00458
Family Myosin rod fragments 0.0085
Further Details:      
 
Domain Number - Region: 3-53
Classification Level Classification E-value
Superfamily ApbE-like 0.0207
Family DVU1097-like 0.012
Further Details:      
 
Domain Number - Region: 105-171
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0549
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ConsensusfromContig10545-maker-ConsensusfromContig10545-snap-gene-0.1-mRNA-1:cds:3507/6777-6828:0:-
Sequence length 194
Sequence
MVNMWGAELEEHVAAFAAYGGAVAKWDRQARPARPARPLLTENGGRIVALHSEVQRIAAA
QEELEMNVNTIAAQQNELELLLNDVEGEVGKLVKANPGMAVSEREQTYQLAEEVDRQLLG
MQDRLRSIIEEMNRGQELAASPESPMGQIVKILNAHLTSLQWVDAQSVDLRKKIASAEES
VKNKAADLERLYRH
Download sequence
Identical sequences ConsensusfromContig10545-maker-ConsensusfromContig10545-snap-gene-0.1-mRNA-1:cds:3507/6777-6828:0:-

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]