SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ConsensusfromContig42092-snap_masked-ConsensusfromContig42092-abinit-gene-0.0-mRNA-1:cds:9807/83-191 from Cyanophora paradoxa

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ConsensusfromContig42092-snap_masked-ConsensusfromContig42092-abinit-gene-0.0-mRNA-1:cds:9807/83-191
Domain Number 1 Region: 4-51
Classification Level Classification E-value
Superfamily ApbE-like 0.00000314
Family ApbE-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ConsensusfromContig42092-snap_masked-ConsensusfromContig42092-abinit-gene-0.0-mRNA-1:cds:9807/83-191
Sequence length 55
Sequence
MLADLPLQGSAAATSGDYFQIYKFGYFHIFDPRRGAAMKATAKSLASATVRGAPV
Download sequence
Identical sequences ConsensusfromContig42092-snap_masked-ConsensusfromContig42092-abinit-gene-0.0-mRNA-1:cds:9807/83-191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]