SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ConsensusfromContig36994-snap_masked-ConsensusfromContig36994-abinit-gene-0.1-mRNA-1:cds:6980/8074-8 from Cyanophora paradoxa

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ConsensusfromContig36994-snap_masked-ConsensusfromContig36994-abinit-gene-0.1-mRNA-1:cds:6980/8074-8
Domain Number 1 Region: 407-460
Classification Level Classification E-value
Superfamily E set domains 0.00000434
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ConsensusfromContig36994-snap_masked-ConsensusfromContig36994-abinit-gene-0.1-mRNA-1:cds:6980/8074-8
Domain Number - Region: 305-380,893-937
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00024
Family Fibronectin type III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ConsensusfromContig36994-snap_masked-ConsensusfromContig36994-abinit-gene-0.1-mRNA-1:cds:6980/8074-8
Sequence length 1473
Sequence
MGSVAERKFVVSNPTGSAVTFDAQLSGLWFTNAAEFVSISTPGSQQSSSCPGCNPSSSSS
FPSETGAFGTRLSTSVNLEKRSSYYGGVGIAAPPCLSGPNSPPCPVNTPVPAPTATPVPY
TSREYSSSGTYIKAWIEIEPAPSPGSLPQLLPGATATVKLSVLGAGVTDFSMPSYTTALA
LTASYEVIVDPEQLYSGSIDESLNAGGSLPFFSYVDTITVLSANPPMNQQNSPWMSSDSR
PMRYFSTYAPSFKVSGSLAESWNSYMYSNYRSVRFDFSREKPRKSLSYSIATSDGYYKES
TVNVYVIGAREDLPDTEALAENCVSLGPLARAARANSNRNYRITELRSMGEYEFSVTANN
AKGKGVKGSKFIVTYGGSSPVGARHVRRVTYNVSRDVCGRSESAPPCFTHTIQERGDGEY
RVKFSLVPRGASFVNVLLDGVLGLEHIPGSPFVVFMYPALNSVPPRLVSAKFSRVGNQIG
ATFDVPTDRAGFLGPADCSRILSLGPESNNTLGAKARCSWIDAKSVLITIGAGATVMPGD
SIVVLPGTVNNMQTSDAVNSSAVIAEPETIAIQGPAKVGSCSPFTARVGVTGTAGGLTSS
GWTVNQAPQALDAILAECNLDFSAGCSFPASIAPGSYSLTFTATNRFKKTFEKLSVNIPM
VTLSGISEGSTRVKTRNVQTIIVARARVDSCDANSQAATGTVDYKWTTPVGTFTGPQIGF
PRDYFSIGTFEMTLAVTAPGLPTVTMPVAVDVAAQPITLTFVGTTQTAARGGRRVIQTQL
IDPDRQSGTPTYSWTMNGASVGATGASYEFDPSAAGGSETVEVTATATLGSRSSNTAKLT
LMLVPAGAPVVSVTAKTTSPLRHNRAYPLGLYGTVTTRPSSENAAVNEKSTLLWEVTEGD
FFNDATTRLTPVDGLGMLVTPFTLSPGASYRFRLTATGVSASEKLKGYSEASLTAFSPPT
PGTCSVSPASGEQIKTRFTLTCSFDTFDESKPLRYQFRTVNSNPSTIYRYADAGVIEDPA
EQRRALLDSETVTAFSTDPTVSALLPAGNGVGRELALVALVSDVDGASIYKLGLAFASYA
ETRSFLVTSAGGLTTLDALGDTASLLSTLDILSPAFESFALTGARGLRRALLQLDASVSE
SLGSMVAMLRSAADKLAISVGSSGASPTTSPAAASATATAPGSGERNLAPDALEQLSSVA
AKVSANAALLSDADLKALTTLVSELVGSYPSAFPDPSADASAQRNLFGAIRNVLFNVTRA
RPASVANGVLSTATAAQRRLAALQRPAVCGATPNIHGNTIVSTCSASAGGAGGRLTSLSG
NVAVSLPPAALAAEVGSETELALSLETTAGSLSPYPTAFDGATLLSEIVTVHASAVNADG
SAGRQVFSGYRGSGGGFTFTFNNVVLPGQSGTSSSSSSSSSANVTKTEFMLYWSERAQKW
VHDTGCGGIATRNANTSFVIDRKIVRLVVNELL
Download sequence
Identical sequences ConsensusfromContig36994-snap_masked-ConsensusfromContig36994-abinit-gene-0.1-mRNA-1:cds:6980/8074-8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]